SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P70232

- CHL1_MOUSE

UniProt

P70232 - CHL1_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Neural cell adhesion molecule L1-like protein
Gene
Chl1, Call
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Extracellular matrix and cell adhesion protein that plays a role in nervous system development and in synaptic plasticity. Both soluble and membranous forms promote neurite outgrowth of cerebellar and hippocampal neurons and suppress neuronal cell death. Plays a role in neuronal positioning of pyramidal neurons as well as in regulation of both the number of interneurons and the efficacy of GABAergic synapses. May play a role in regulating cell migration in nerve regeneration and cortical development. Potentiates integrin-dependent cell migration towards extracellular matrix proteins. Recruits ANK3 to the plasma membrane.9 Publications

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei753 – 7542Cleavage; by ADAM8
Sitei1040 – 10412Cleavage; by ADAM8

GO - Molecular functioni

  1. protease binding Source: BHF-UCL
  2. protein binding Source: IntAct
Complete GO annotation...

GO - Biological processi

  1. adult locomotory behavior Source: MGI
  2. axon guidance Source: MGI
  3. cell adhesion Source: UniProtKB-KW
  4. cognition Source: MGI
  5. exploration behavior Source: MGI
  6. negative regulation of neuron apoptotic process Source: BHF-UCL
  7. neuron migration Source: MGI
  8. neuron projection development Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Cell adhesion, Differentiation, Neurogenesis

Enzyme and pathway databases

ReactomeiREACT_198267. CHL1 interactions.

Names & Taxonomyi

Protein namesi
Recommended name:
Neural cell adhesion molecule L1-like protein
Alternative name(s):
Cell adhesion molecule with homology to L1CAM
Chl1-like protein
Close homolog of L1
Cleaved into the following chain:
Gene namesi
Name:Chl1
Synonyms:Call
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 6

Organism-specific databases

MGIiMGI:1098266. Chl1.

Subcellular locationi

Cell membrane; Single-pass type I membrane protein
Note: Soluble forms produced by cleavage/shedding also exist.

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini26 – 10831058Extracellular Reviewed prediction
Add
BLAST
Transmembranei1084 – 110421Helical; Reviewed prediction
Add
BLAST
Topological domaini1105 – 1209105Cytoplasmic Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. apical part of cell Source: MGI
  2. dendrite Source: MGI
  3. integral component of membrane Source: UniProtKB-KW
  4. plasma membrane Source: Reactome
  5. proteinaceous extracellular matrix Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Extracellular matrix, Membrane, Secreted

Pathology & Biotechi

Disruption phenotypei

Mice exhibit misguided axonal projections and aberrant axonal connectivity. They show alterations of hippocampal fiber organization and olfactory axon projections. Their exploratory behavior in novel environments is altered suggesting deficits in information processing and in attention. They also display signs of decreased stress and are more sociable and less aggressive. Heterozygous mice exhibit half levels of CHL1 expression in the hippocampus compared to their wild-type littermates, reflecting a gene dosage effect.4 Publications

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi555 – 5584DGEA → AGEV: Inhibition of migration potentiation. 1 Publication
Mutagenesisi1186 – 11861Y → A: Inhibition of migration potentiation. 1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2525 Reviewed prediction
Add
BLAST
Chaini26 – 12091184Neural cell adhesion molecule L1-like protein
PRO_0000247897Add
BLAST
Chaini26 – ?Processed neural cell adhesion molecule L1-like protein Reviewed predictionPRO_0000314778

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi57 ↔ 109 By similarity
Glycosylationi87 – 871N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi153 ↔ 204 By similarity
Glycosylationi225 – 2251N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi262 ↔ 310 By similarity
Glycosylationi299 – 2991N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi352 ↔ 401 By similarity
Disulfide bondi445 ↔ 494 By similarity
Glycosylationi476 – 4761N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi536 ↔ 591 By similarity
Glycosylationi562 – 5621N-linked (GlcNAc...) Reviewed prediction
Glycosylationi580 – 5801N-linked (GlcNAc...) Reviewed prediction
Glycosylationi767 – 7671N-linked (GlcNAc...) Reviewed prediction
Glycosylationi822 – 8221N-linked (GlcNAc...) Reviewed prediction
Glycosylationi945 – 9451N-linked (GlcNAc...) Reviewed prediction
Glycosylationi1027 – 10271N-linked (GlcNAc...) Reviewed prediction

Post-translational modificationi

Cleavage by metalloprotease ADAM8 in the extracellular part generates 2 soluble forms (125 kDa and 165 kDa) in vitro and is inhibited by metalloprotease inhibitors. In brain extracts, these two soluble forms are also present and are dramatically reduced in mice lacking ADAM8.
N-glycosylated. Contains N-linked oligosaccharides with a sulfated carbohydrate structure type HNK-1 (SO4-3-GlcUABeta1,3GalBeta1,4GlcNAc).1 Publication
O-glycosylated.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiP70232.
PRIDEiP70232.

PTM databases

PhosphoSiteiP70232.

Expressioni

Tissue specificityi

Expressed in the brain, in the cerebellum and in the spinal cord. Detected in the retina and the optic nerve. Expressed in neurons and glial cells in the central nervous system and by Schwann cells in the peripheral nervous system.3 Publications

Developmental stagei

Not detectable in the forebrain at E11, weakly detectable at E13 with highest detection at E18 to postnatal day 7. Down-regulated at postnatal day 15 and further reduced in four-week-old animals.3 Publications

Gene expression databases

CleanExiMM_CHL1.
GenevestigatoriP70232.

Interactioni

Subunit structurei

May interact with L1CAM. May interact with ITGB1/ITGA1 heterodimer and ITGB1/ITGA2 heterodimer as well as with ANK3.

Binary interactionsi

WithEntry#Exp.IntActNotes
Cntn6Q9JMB85EBI-7703109,EBI-7703151
PtpraP180524EBI-7703109,EBI-6597520

Protein-protein interaction databases

BioGridi198702. 1 interaction.
IntActiP70232. 3 interactions.
MINTiMINT-4106227.

Structurei

3D structure databases

ProteinModelPortaliP70232.
SMRiP70232. Positions 31-1002.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini35 – 12490Ig-like C2-type 1
Add
BLAST
Domaini128 – 22396Ig-like C2-type 2
Add
BLAST
Domaini235 – 32894Ig-like C2-type 3
Add
BLAST
Domaini331 – 41787Ig-like C2-type 4
Add
BLAST
Domaini423 – 51088Ig-like C2-type 5
Add
BLAST
Domaini515 – 60793Ig-like C2-type 6
Add
BLAST
Domaini614 – 70996Fibronectin type-III 1
Add
BLAST
Domaini714 – 80794Fibronectin type-III 2
Add
BLAST
Domaini812 – 914103Fibronectin type-III 3
Add
BLAST
Domaini918 – 101598Fibronectin type-III 4
Add
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi555 – 5584DGEA
Motifi1182 – 11865FIG[AQ]Y

Domaini

The FIG[AQ]Y motif seems to be an ankyrin recruitment region.
The DGEA motif seems to be a recognition site for integrin.

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG256023.
GeneTreeiENSGT00690000101868.
HOGENOMiHOG000231380.
HOVERGENiHBG000144.
KOiK06758.
OMAiYVRYQFR.
OrthoDBiEOG7R56RM.
TreeFamiTF351098.

Family and domain databases

Gene3Di2.60.40.10. 10 hits.
InterProiIPR003961. Fibronectin_type3.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR026966. Neurofascin/L1/NrCAM_C.
[Graphical view]
PfamiPF13882. Bravo_FIGEY. 1 hit.
PF00041. fn3. 4 hits.
PF07679. I-set. 4 hits.
[Graphical view]
SMARTiSM00060. FN3. 4 hits.
SM00409. IG. 2 hits.
SM00408. IGc2. 3 hits.
[Graphical view]
SUPFAMiSSF49265. SSF49265. 2 hits.
PROSITEiPS50853. FN3. 4 hits.
PS50835. IG_LIKE. 6 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P70232-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MMELPLCGRG LILSLIFLLL KLSAAEIPLS VQQVPTIVKQ SYVQVAFPFD     50
EYFQIECEAK GNPEPIFSWT KDDKPFDLSD PRIIAANNSG TFKIPNEGHI 100
SHFQGKYRCF ASNRLGTAVS EEIEFIVPGV PKFPKEKIEP IDVEEGDSIV 150
LPCNPPKGLP PLHIYWMNIE LEHIEQDERV YMSQRGDLYF ANVEENDSRN 200
DYCCFAAFPK LRTIVQKMPM KLTVNSSNSI KQRKPKLLLP PAQMGSLSAK 250
TVLKGDTLLL ECFAEGLPTP HIQWSKPGSE LPEGRATIEV HEKTLKIENI 300
SYQDRGNYRC TANNLLGKAS HDFHVTVEEP PRWKKKPQSA VYSTGSSGIL 350
LCEAEGEPQP TIKWRLNGLP IEKHPFPGDF MFPREISFTN LLPNHTGVYQ 400
CEASNIHGTI LANANIDVID VIPLIKTKNE ENYATVVGYS AFLHCEYFAS 450
PKATVVWEVA DETHPLEGDR YHTHENGTLE IYRTTEEDAG SYSCWVDNAM 500
GKAVITANLD IRNATKLRVS PKNPRIPKSH VLELYCESQC DSHLKHSLKL 550
SWSKDGEAFE MNGTEDGRIV IDGAYLTISN ITAEDQGVYS CSAQTSLDST 600
SEKTQVTVLG VPDPPGNLHL SERQNRSVRL SWEAGDDHNS KISEYIVEFE 650
GNREEPGKWE ELTRVQGEET DVVLSLAPYV RYQFRVTAVN EVGRSHASLP 700
SDHHETPPAA PDKNPQNIRV QASQPKEMII KWEPLKSMEQ NGPGLEYKVS 750
WKPQGAPEEW EEEIVTNHTL RVMTPTVYAP YDVKVQAINQ LGSSPDPQPV 800
TLYSGEDYPS TAPVIQRVDV MNSTLVKVTW SSIPKETVHG LLRGYQINWW 850
KTKSLLDGRT HPKEVNILRF SGQRNSGMVP SLDPFSEFHL TVLAYNSKGA 900
GPESEPYIFQ TPEGVPEQPS FLKVIKVDKD TATLSWGLPK KLNGNLTGYL 950
LQYQIINDTY ELGELNEINV TTPSKSSWHL SNLNSTTKYK FYLRACTSRG 1000
CGKPISEEGA TLGEGSKGIR KITEGVNVTQ KIHPVEVLVP GAEHIVHLMT 1050
KNWGDNDSIF QDVIETRGRE YAGLYDDIST QGWFIGLMCA IALLTLILLT 1100
ICFVKRNRGG KYSVKEKEDL HPDPEVQSAK DETFGEYSDS DEKPLKGSLR 1150
SLNRNMQPTE SADSLVEYGE GDQSIFNEDG SFIGAYTGAK EKGSVESNGS 1200
STATFPLRA 1209
Length:1,209
Mass (Da):135,074
Last modified:October 3, 2012 - v2
Checksum:i2C689475920AB84C
GO
Isoform 2 (identifier: P70232-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     227-227: S → LKHASDSSSSTEICSQA
     1016-1070: SKGIRKITEGVNVTQKIHPVEVLVPGAEHIVHLMTKNWGDNDSIFQDVIETRGRE → K
     1138-1209: SDSDEKPLKG...SSTATFPLRA → RKMVLKQKLL...LRYFSSNKHT

Show »
Length:1,150
Mass (Da):129,001
Checksum:i6CF6C082529C7A99
GO

Sequence cautioni

The sequence BAC30699.1 differs from that shown. Reason: Frameshift at positions 616, 624, 631, 632, 642 and 645.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei227 – 2271S → LKHASDSSSSTEICSQA in isoform 2.
VSP_020083
Alternative sequencei1016 – 107055SKGIR…TRGRE → K in isoform 2.
VSP_020084Add
BLAST
Alternative sequencei1138 – 120972SDSDE…FPLRA → RKMVLKQKLLSWSSSRGRTF YSCTKNTLFDGSSVDMKTLQ PLRYFSSNKHT in isoform 2.
VSP_020085Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti50 – 501D → G in BAC35247. 1 Publication
Sequence conflicti77 – 771D → E in CAC88131. 1 Publication
Sequence conflicti425 – 4251I → V in BAC35247. 1 Publication
Sequence conflicti602 – 6021E → K in CAA63972. 1 Publication
Sequence conflicti612 – 6121P → G in CAA63972. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X94310 mRNA. Translation: CAA63972.1.
AK040765 mRNA. Translation: BAC30699.1. Frameshift.
AK048639 mRNA. Translation: BAC33405.1.
AK053039 mRNA. Translation: BAC35247.2.
AC153595 Genomic DNA. No translation available.
AC153598 Genomic DNA. No translation available.
AC161824 Genomic DNA. No translation available.
CH466523 Genomic DNA. Translation: EDK99388.1.
BC131670 mRNA. Translation: AAI31671.1.
BC131671 mRNA. Translation: AAI31672.1.
AJ319655, AJ319656, AJ319657 Genomic DNA. Translation: CAC88131.1.
CCDSiCCDS39582.1. [P70232-1]
PIRiT42718.
RefSeqiNP_031723.2. NM_007697.2. [P70232-1]
XP_006505535.1. XM_006505472.1. [P70232-1]
UniGeneiMm.251288.

Genome annotation databases

EnsembliENSMUST00000066905; ENSMUSP00000063933; ENSMUSG00000030077. [P70232-1]
GeneIDi12661.
KEGGimmu:12661.
UCSCiuc009dcj.1. mouse.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X94310 mRNA. Translation: CAA63972.1 .
AK040765 mRNA. Translation: BAC30699.1 . Frameshift.
AK048639 mRNA. Translation: BAC33405.1 .
AK053039 mRNA. Translation: BAC35247.2 .
AC153595 Genomic DNA. No translation available.
AC153598 Genomic DNA. No translation available.
AC161824 Genomic DNA. No translation available.
CH466523 Genomic DNA. Translation: EDK99388.1 .
BC131670 mRNA. Translation: AAI31671.1 .
BC131671 mRNA. Translation: AAI31672.1 .
AJ319655 , AJ319656 , AJ319657 Genomic DNA. Translation: CAC88131.1 .
CCDSi CCDS39582.1. [P70232-1 ]
PIRi T42718.
RefSeqi NP_031723.2. NM_007697.2. [P70232-1 ]
XP_006505535.1. XM_006505472.1. [P70232-1 ]
UniGenei Mm.251288.

3D structure databases

ProteinModelPortali P70232.
SMRi P70232. Positions 31-1002.
ModBasei Search...

Protein-protein interaction databases

BioGridi 198702. 1 interaction.
IntActi P70232. 3 interactions.
MINTi MINT-4106227.

PTM databases

PhosphoSitei P70232.

Proteomic databases

PaxDbi P70232.
PRIDEi P70232.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000066905 ; ENSMUSP00000063933 ; ENSMUSG00000030077 . [P70232-1 ]
GeneIDi 12661.
KEGGi mmu:12661.
UCSCi uc009dcj.1. mouse.

Organism-specific databases

CTDi 10752.
MGIi MGI:1098266. Chl1.

Phylogenomic databases

eggNOGi NOG256023.
GeneTreei ENSGT00690000101868.
HOGENOMi HOG000231380.
HOVERGENi HBG000144.
KOi K06758.
OMAi YVRYQFR.
OrthoDBi EOG7R56RM.
TreeFami TF351098.

Enzyme and pathway databases

Reactomei REACT_198267. CHL1 interactions.

Miscellaneous databases

NextBioi 281890.
PROi P70232.
SOURCEi Search...

Gene expression databases

CleanExi MM_CHL1.
Genevestigatori P70232.

Family and domain databases

Gene3Di 2.60.40.10. 10 hits.
InterProi IPR003961. Fibronectin_type3.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR026966. Neurofascin/L1/NrCAM_C.
[Graphical view ]
Pfami PF13882. Bravo_FIGEY. 1 hit.
PF00041. fn3. 4 hits.
PF07679. I-set. 4 hits.
[Graphical view ]
SMARTi SM00060. FN3. 4 hits.
SM00409. IG. 2 hits.
SM00408. IGc2. 3 hits.
[Graphical view ]
SUPFAMi SSF49265. SSF49265. 2 hits.
PROSITEi PS50853. FN3. 4 hits.
PS50835. IG_LIKE. 6 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Structural features of a close homologue of L1 (CHL1) in the mouse: a new member of the L1 family of neural recognition molecules."
    Holm J., Hillenbrand R., Steuber V., Bartsch U., Moos M., Luebbert H., Montag D., Schachner M.
    Eur. J. Neurosci. 8:1613-1629(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, GLYCOSYLATION, DEVELOPMENTAL STAGE.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-425 AND 666-1209 (ISOFORM 1).
    Strain: C57BL/6J.
    Tissue: Aorta, Head and Vein.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  4. Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.
    Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
  6. "Misguided axonal projections, neural cell adhesion molecule 180 mRNA upregulation, and altered behavior in mice deficient for the close homolog of L1."
    Montag-Sallaz M., Schachner M., Montag D.
    Mol. Cell. Biol. 22:7967-7981(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-129, FUNCTION, DISRUPTION PHENOTYPE.
    Strain: 129/Sv.
  7. "The close homologue of the neural adhesion molecule L1 (CHL1): patterns of expression and promotion of neurite outgrowth by heterophilic interactions."
    Hillenbrand R., Molthagen M., Montag D., Schachner M.
    Eur. J. Neurosci. 11:813-826(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, DEVELOPMENTAL STAGE, INTERACTION WITH L1CAM, TISSUE SPECIFICITY.
  8. "Prevention of neuronal cell death by neural adhesion molecules L1 and CHL1."
    Chen S., Mantei N., Dong L., Schachner M.
    J. Neurobiol. 38:428-439(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  9. "Mice deficient for the close homologue of the neural adhesion cell L1 (CHL1) display alterations in emotional reactivity and motor coordination."
    Pratte M., Rougon G., Schachner M., Jamon M.
    Behav. Brain Res. 147:31-39(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, DISRUPTION PHENOTYPE.
  10. "CALL interrupted in a patient with non-specific mental retardation: gene dosage-dependent alteration of murine brain development and behavior."
    Frints S.G.M., Marynen P., Hartmann D., Fryns J.-P., Steyaert J., Schachner M., Rolf B., Craessaerts K., Snellinx A., Hollanders K., D'Hooge R., De Deyn P.P., Froyen G.
    Hum. Mol. Genet. 12:1463-1474(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, DISRUPTION PHENOTYPE.
  11. "Close homolog of L1 is an enhancer of integrin-mediated cell migration."
    Buhusi M., Midkiff B.R., Gates A.M., Richter M., Schachner M., Maness P.F.
    J. Biol. Chem. 278:25024-25031(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH ANK3; ITGB1/ITGA1 HETERODIMER AND ITGB1/ITGA2 HETERODIMER, MOTIFS, MUTAGENESIS OF 555-ASP--ALA-558 AND TYR-1186.
  12. "Ectodomain shedding of the neural recognition molecule CHL1 by the metalloprotease-disintegrin ADAM8 promotes neurite outgrowth and suppresses neuronal cell death."
    Naus S., Richter M., Wildeboer D., Moss M., Schachner M., Bartsch J.W.
    J. Biol. Chem. 279:16083-16090(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, CLEAVAGE BY ADAM8.
  13. "Close homolog of L1 modulates area-specific neuronal positioning and dendrite orientation in the cerebral cortex."
    Demyanenko G.P., Schachner M., Anton E., Schmid R., Feng G., Sanes J., Maness P.F.
    Neuron 44:423-437(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
  14. "Enhanced perisomatic inhibition and impaired long-term potentiation in the CA1 region of juvenile CHL1-deficient mice."
    Nikonenko A.G., Sun M., Lepsveridze E., Apostolova I., Petrova I., Irintchev A., Dityatev A., Schachner M.
    Eur. J. Neurosci. 23:1839-1852(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, DISRUPTION PHENOTYPE.

Entry informationi

Entry nameiCHL1_MOUSE
AccessioniPrimary (citable) accession number: P70232
Secondary accession number(s): A2RRK1
, Q8BS24, Q8C6W0, Q8C823, Q8VBY7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 25, 2006
Last sequence update: October 3, 2012
Last modified: September 3, 2014
This is version 117 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi