P70232 (CHL1_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 103.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Neural cell adhesion molecule L1-like protein Alternative name(s): Cell adhesion molecule with homology to L1CAM Chl1-like protein Close homolog of L1 Cleaved into the following chain: | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 1209 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Extracellular matrix and cell adhesion protein that plays a role in nervous system development and in synaptic plasticity. Both soluble and membranous forms promote neurite outgrowth of cerebellar and hippocampal neurons and suppress neuronal cell death. Plays a role in neuronal positioning of pyramidal neurons as well as in regulation of both the number of interneurons and the efficacy of GABAergic synapses. May play a role in regulating cell migration in nerve regeneration and cortical development. Potentiates integrin-dependent cell migration towards extracellular matrix proteins. Recruits ANK3 to the plasma membrane. Ref.6 Ref.7 Ref.8 Ref.9 Ref.10 Ref.11 Ref.12 Ref.13 Ref.14 |
| Subunit structure | May interact with L1CAM. May interact with ITGB1/ITGA1 heterodimer and ITGB1/ITGA2 heterodimer as well as with ANK3. |
| Subcellular location | Cell membrane; Single-pass type I membrane protein. Note: Soluble forms produced by cleavage/shedding also exist. Processed neural cell adhesion molecule L1-like protein: Secreted › extracellular space › extracellular matrix. |
| Tissue specificity | Expressed in the brain, in the cerebellum and in the spinal cord. Detected in the retina and the optic nerve. Expressed in neurons and glial cells in the central nervous system and by Schwann cells in the peripheral nervous system. Ref.1 Ref.7 Ref.13 |
| Developmental stage | Not detectable in the forebrain at E11, weakly detectable at E13 with highest detection at E18 to postnatal day 7. Down-regulated at postnatal day 15 and further reduced in four-week-old animals. Ref.1 Ref.7 Ref.13 |
| Domain | The FIG[AQ]Y motif seems to be an ankyrin recruitment region. The DGEA motif seems to be a recognition site for integrin. |
| Post-translational modification | Cleavage by metalloprotease ADAM8 in the extracellular part generates 2 soluble forms (125 kDa and 165 kDa) in vitro and is inhibited by metalloprotease inhibitors. In brain extracts, these two soluble forms are also present and are dramatically reduced in mice lacking ADAM8. N-glycosylated. Contains N-linked oligosaccharides with a sulfated carbohydrate structure type HNK-1 (SO4-3-GlcUABeta1,3GalBeta1,4GlcNAc). Ref.1 O-glycosylated. Ref.1 |
| Disruption phenotype | Mice exhibit misguided axonal projections and aberrant axonal connectivity. They show alterations of hippocampal fiber organization and olfactory axon projections. Their exploratory behavior in novel environments is altered suggesting deficits in information processing and in attention. They also display signs of decreased stress and are more sociable and less aggressive. Heterozygous mice exhibit half levels of CHL1 expression in the hippocampus compared to their wild-type littermates, reflecting a gene dosage effect. Ref.6 Ref.9 Ref.10 Ref.14 |
| Sequence similarities | Belongs to the immunoglobulin superfamily. L1/neurofascin/NgCAM family. Contains 4 fibronectin type-III domains. Contains 6 Ig-like C2-type (immunoglobulin-like) domains. |
| Sequence caution | The sequence BAC30699.1 differs from that shown. Reason: Frameshift at positions 616, 624, 631, 632, 642 and 645. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P70232-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P70232-2) The sequence of this isoform differs from the canonical sequence as follows: 227-227: S → LKHASDSSSSTEICSQA 1016-1070: SKGIRKITEGVNVTQKIHPVEVLVPGAEHIVHLMTKNWGDNDSIFQDVIETRGRE → K 1138-1209: SDSDEKPLKG...SSTATFPLRA → RKMVLKQKLL...LRYFSSNKHT |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 25 | 25 | Potential | ||||||||
| Chain | 26 – 1209 | 1184 | Neural cell adhesion molecule L1-like protein | PRO_0000247897 | |||||||
| Chain | 26 – ? | Processed neural cell adhesion molecule L1-like protein Potential | PRO_0000314778 | ||||||||
Regions | |||||||||||
| Topological domain | 26 – 1083 | 1058 | Extracellular Potential | ||||||||
| Transmembrane | 1084 – 1104 | 21 | Helical; Potential | ||||||||
| Topological domain | 1105 – 1209 | 105 | Cytoplasmic Potential | ||||||||
| Domain | 35 – 124 | 90 | Ig-like C2-type 1 | ||||||||
| Domain | 128 – 223 | 96 | Ig-like C2-type 2 | ||||||||
| Domain | 235 – 328 | 94 | Ig-like C2-type 3 | ||||||||
| Domain | 331 – 417 | 87 | Ig-like C2-type 4 | ||||||||
| Domain | 423 – 510 | 88 | Ig-like C2-type 5 | ||||||||
| Domain | 515 – 607 | 93 | Ig-like C2-type 6 | ||||||||
| Domain | 611 – 707 | 97 | Fibronectin type-III 1 | ||||||||
| Domain | 711 – 804 | 94 | Fibronectin type-III 2 | ||||||||
| Domain | 809 – 911 | 103 | Fibronectin type-III 3 | ||||||||
| Domain | 916 – 1011 | 96 | Fibronectin type-III 4 | ||||||||
| Motif | 555 – 558 | 4 | DGEA | ||||||||
| Motif | 1182 – 1186 | 5 | FIG[AQ]Y | ||||||||
Sites | |||||||||||
| Site | 753 – 754 | 2 | Cleavage; by ADAM8 | ||||||||
| Site | 1040 – 1041 | 2 | Cleavage; by ADAM8 | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 1128 | 1 | Phosphoserine Ref.15 | ||||||||
| Modified residue | 1148 | 1 | Phosphoserine Ref.15 | ||||||||
| Glycosylation | 87 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 225 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 299 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 476 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 562 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 580 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 767 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 822 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 945 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1027 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 57 ↔ 109 | By similarity | |||||||||
| Disulfide bond | 153 ↔ 204 | By similarity | |||||||||
| Disulfide bond | 262 ↔ 310 | By similarity | |||||||||
| Disulfide bond | 352 ↔ 401 | By similarity | |||||||||
| Disulfide bond | 445 ↔ 494 | By similarity | |||||||||
| Disulfide bond | 536 ↔ 591 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 227 | 1 | S → LKHASDSSSSTEICSQA in isoform 2. | VSP_020083 | |||||||
| Alternative sequence | 1016 – 1070 | 55 | SKGIR…TRGRE → K in isoform 2. | VSP_020084 | |||||||
| Alternative sequence | 1138 – 1209 | 72 | SDSDE…FPLRA → RKMVLKQKLLSWSSSRGRTF YSCTKNTLFDGSSVDMKTLQ PLRYFSSNKHT in isoform 2. | VSP_020085 | |||||||
Experimental info | |||||||||||
| Mutagenesis | 555 – 558 | 4 | DGEA → AGEV: Inhibition of migration potentiation. Ref.11 | ||||||||
| Mutagenesis | 1186 | 1 | Y → A: Inhibition of migration potentiation. Ref.11 | ||||||||
| Sequence conflict | 50 | 1 | D → G in BAC35247. Ref.2 | ||||||||
| Sequence conflict | 77 | 1 | D → E in CAC88131. Ref.6 | ||||||||
| Sequence conflict | 425 | 1 | I → V in BAC35247. Ref.2 | ||||||||
| Sequence conflict | 602 | 1 | E → K in CAA63972. Ref.1 | ||||||||
| Sequence conflict | 612 | 1 | P → G in CAA63972. Ref.1 | ||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Structural features of a close homologue of L1 (CHL1) in the mouse: a new member of the L1 family of neural recognition molecules." Holm J., Hillenbrand R., Steuber V., Bartsch U., Moos M., Luebbert H., Montag D., Schachner M. Eur. J. Neurosci. 8:1613-1629(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, GLYCOSYLATION, DEVELOPMENTAL STAGE. |
| [2] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-425 AND 666-1209 (ISOFORM 1). Strain: C57BL/6J. Tissue: Aorta, Head and Vein. |
| [3] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6J. |
| [4] | Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C. Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]. |
| [6] | "Misguided axonal projections, neural cell adhesion molecule 180 mRNA upregulation, and altered behavior in mice deficient for the close homolog of L1." Montag-Sallaz M., Schachner M., Montag D. Mol. Cell. Biol. 22:7967-7981(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-129, FUNCTION, DISRUPTION PHENOTYPE. Strain: 129/Sv. |
| [7] | "The close homologue of the neural adhesion molecule L1 (CHL1): patterns of expression and promotion of neurite outgrowth by heterophilic interactions." Hillenbrand R., Molthagen M., Montag D., Schachner M. Eur. J. Neurosci. 11:813-826(1999) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, DEVELOPMENTAL STAGE, INTERACTION WITH L1CAM, TISSUE SPECIFICITY. |
| [8] | "Prevention of neuronal cell death by neural adhesion molecules L1 and CHL1." Chen S., Mantei N., Dong L., Schachner M. J. Neurobiol. 38:428-439(1999) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [9] | "Mice deficient for the close homologue of the neural adhesion cell L1 (CHL1) display alterations in emotional reactivity and motor coordination." Pratte M., Rougon G., Schachner M., Jamon M. Behav. Brain Res. 147:31-39(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, DISRUPTION PHENOTYPE. |
| [10] | "CALL interrupted in a patient with non-specific mental retardation: gene dosage-dependent alteration of murine brain development and behavior." Frints S.G.M., Marynen P., Hartmann D., Fryns J.-P., Steyaert J., Schachner M., Rolf B., Craessaerts K., Snellinx A., Hollanders K., D'Hooge R., De Deyn P.P., Froyen G. Hum. Mol. Genet. 12:1463-1474(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, DISRUPTION PHENOTYPE. |
| [11] | "Close homolog of L1 is an enhancer of integrin-mediated cell migration." Buhusi M., Midkiff B.R., Gates A.M., Richter M., Schachner M., Maness P.F. J. Biol. Chem. 278:25024-25031(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH ANK3; ITGB1/ITGA1 HETERODIMER AND ITGB1/ITGA2 HETERODIMER, MOTIFS, MUTAGENESIS OF 555-ASP--ALA-558 AND TYR-1186. |
| [12] | "Ectodomain shedding of the neural recognition molecule CHL1 by the metalloprotease-disintegrin ADAM8 promotes neurite outgrowth and suppresses neuronal cell death." Naus S., Richter M., Wildeboer D., Moss M., Schachner M., Bartsch J.W. J. Biol. Chem. 279:16083-16090(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, CLEAVAGE BY ADAM8. |
| [13] | "Close homolog of L1 modulates area-specific neuronal positioning and dendrite orientation in the cerebral cortex." Demyanenko G.P., Schachner M., Anton E., Schmid R., Feng G., Sanes J., Maness P.F. Neuron 44:423-437(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE. |
| [14] | "Enhanced perisomatic inhibition and impaired long-term potentiation in the CA1 region of juvenile CHL1-deficient mice." Nikonenko A.G., Sun M., Lepsveridze E., Apostolova I., Petrova I., Irintchev A., Dityatev A., Schachner M. Eur. J. Neurosci. 23:1839-1852(2006) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, DISRUPTION PHENOTYPE. |
| [15] | "Solid tumor proteome and phosphoproteome analysis by high resolution mass spectrometry." Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J., Faessler R., Mann M. J. Proteome Res. 7:5314-5326(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1128 AND SER-1148, MASS SPECTROMETRY. Tissue: Melanoma. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X94310 mRNA. Translation: CAA63972.1. AK040765 mRNA. Translation: BAC30699.1. Frameshift. AK048639 mRNA. Translation: BAC33405.1. AK053039 mRNA. Translation: BAC35247.2. AC153595 Genomic DNA. No translation available. AC153598 Genomic DNA. No translation available. AC161824 Genomic DNA. No translation available. CH466523 Genomic DNA. Translation: EDK99388.1. BC131670 mRNA. Translation: AAI31671.1. BC131671 mRNA. Translation: AAI31672.1. AJ319655, AJ319656, AJ319657 Genomic DNA. Translation: CAC88131.1. |
| IPI | IPI00222149. IPI00404529. IPI00831546. |
| PIR | T42718. |
| RefSeq | NP_031723.2. NM_007697.2. |
| UniGene | Mm.251288. |
3D structure databases | |
| ProteinModelPortal | P70232. |
| SMR | P70232. Positions 31-1002. |
| ModBase | Search... |
Protein-protein interaction databases | |
| MINT | MINT-4106227. |
PTM databases | |
| PhosphoSite | P70232. |
Proteomic databases | |
| PaxDb | P70232. |
| PRIDE | P70232. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000066905; ENSMUSP00000063933; ENSMUSG00000030077. |
| GeneID | 12661. |
| KEGG | mmu:12661. |
Organism-specific databases | |
| CTD | 10752. |
| MGI | MGI:1098266. Chl1. |
Phylogenomic databases | |
| eggNOG | NOG256023. |
| GeneTree | ENSGT00690000101868. |
| HOGENOM | HOG000231380. |
| HOVERGEN | HBG000144. |
| KO | K06758. |
| OMA | WEAGDDH. |
| OrthoDB | EOG4RFKRR. |
Enzyme and pathway databases | |
| Reactome | REACT_127416. Developmental Biology. |
Gene expression databases | |
| CleanEx | MM_CHL1. |
| Genevestigator | P70232. |
| GermOnline | ENSMUSG00000030077. Mus musculus. |
Family and domain databases | |
| Gene3D | 2.60.40.10. 10 hits. |
| InterPro | IPR026966. Fibronectin_III_C. IPR003961. Fibronectin_type3. IPR007110. Ig-like_dom. IPR013783. Ig-like_fold. IPR013098. Ig_I-set. IPR003599. Ig_sub. IPR003598. Ig_sub2. [Graphical view] |
| Pfam | PF13882. Bravo_FIGEY. 1 hit. PF00041. fn3. 4 hits. PF07679. I-set. 4 hits. [Graphical view] |
| SMART | SM00060. FN3. 4 hits. SM00409. IG. 2 hits. SM00408. IGc2. 3 hits. [Graphical view] |
| SUPFAM | SSF49265. FN_III-like. 4 hits. |
| PROSITE | PS50853. FN3. 4 hits. PS50835. IG_LIKE. 6 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 281890. |
| SOURCE | Search... |
Entry information
| Entry name | CHL1_MOUSE | ||||||||
| Accession | Primary (citable) accession number: P70232 Secondary accession number(s): A2RRK1 Q8VBY7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
