Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P70232

- CHL1_MOUSE

UniProt

P70232 - CHL1_MOUSE

Protein

Neural cell adhesion molecule L1-like protein

Gene

Chl1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 118 (01 Oct 2014)
      Sequence version 2 (03 Oct 2012)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Extracellular matrix and cell adhesion protein that plays a role in nervous system development and in synaptic plasticity. Both soluble and membranous forms promote neurite outgrowth of cerebellar and hippocampal neurons and suppress neuronal cell death. Plays a role in neuronal positioning of pyramidal neurons as well as in regulation of both the number of interneurons and the efficacy of GABAergic synapses. May play a role in regulating cell migration in nerve regeneration and cortical development. Potentiates integrin-dependent cell migration towards extracellular matrix proteins. Recruits ANK3 to the plasma membrane.9 Publications

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sitei753 – 7542Cleavage; by ADAM8
    Sitei1040 – 10412Cleavage; by ADAM8

    GO - Molecular functioni

    1. protease binding Source: BHF-UCL
    2. protein binding Source: IntAct

    GO - Biological processi

    1. adult locomotory behavior Source: MGI
    2. axon guidance Source: MGI
    3. cell adhesion Source: UniProtKB-KW
    4. cognition Source: MGI
    5. exploration behavior Source: MGI
    6. negative regulation of neuron apoptotic process Source: BHF-UCL
    7. neuron migration Source: MGI
    8. neuron projection development Source: MGI

    Keywords - Molecular functioni

    Developmental protein

    Keywords - Biological processi

    Cell adhesion, Differentiation, Neurogenesis

    Enzyme and pathway databases

    ReactomeiREACT_198267. CHL1 interactions.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Neural cell adhesion molecule L1-like protein
    Alternative name(s):
    Cell adhesion molecule with homology to L1CAM
    Chl1-like protein
    Close homolog of L1
    Cleaved into the following chain:
    Gene namesi
    Name:Chl1
    Synonyms:Call
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 6

    Organism-specific databases

    MGIiMGI:1098266. Chl1.

    Subcellular locationi

    Cell membrane; Single-pass type I membrane protein
    Note: Soluble forms produced by cleavage/shedding also exist.

    GO - Cellular componenti

    1. apical part of cell Source: MGI
    2. dendrite Source: MGI
    3. integral component of membrane Source: UniProtKB-KW
    4. plasma membrane Source: Reactome
    5. proteinaceous extracellular matrix Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell membrane, Extracellular matrix, Membrane, Secreted

    Pathology & Biotechi

    Disruption phenotypei

    Mice exhibit misguided axonal projections and aberrant axonal connectivity. They show alterations of hippocampal fiber organization and olfactory axon projections. Their exploratory behavior in novel environments is altered suggesting deficits in information processing and in attention. They also display signs of decreased stress and are more sociable and less aggressive. Heterozygous mice exhibit half levels of CHL1 expression in the hippocampus compared to their wild-type littermates, reflecting a gene dosage effect.4 Publications

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi555 – 5584DGEA → AGEV: Inhibition of migration potentiation.
    Mutagenesisi1186 – 11861Y → A: Inhibition of migration potentiation. 1 Publication

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2525Sequence AnalysisAdd
    BLAST
    Chaini26 – 12091184Neural cell adhesion molecule L1-like proteinPRO_0000247897Add
    BLAST
    Chaini26 – ?Processed neural cell adhesion molecule L1-like proteinSequence AnalysisPRO_0000314778

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi57 ↔ 109PROSITE-ProRule annotation
    Glycosylationi87 – 871N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi153 ↔ 204PROSITE-ProRule annotation
    Glycosylationi225 – 2251N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi262 ↔ 310PROSITE-ProRule annotation
    Glycosylationi299 – 2991N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi352 ↔ 401PROSITE-ProRule annotation
    Disulfide bondi445 ↔ 494PROSITE-ProRule annotation
    Glycosylationi476 – 4761N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi536 ↔ 591PROSITE-ProRule annotation
    Glycosylationi562 – 5621N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi580 – 5801N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi767 – 7671N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi822 – 8221N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi945 – 9451N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1027 – 10271N-linked (GlcNAc...)Sequence Analysis

    Post-translational modificationi

    Cleavage by metalloprotease ADAM8 in the extracellular part generates 2 soluble forms (125 kDa and 165 kDa) in vitro and is inhibited by metalloprotease inhibitors. In brain extracts, these two soluble forms are also present and are dramatically reduced in mice lacking ADAM8.
    N-glycosylated. Contains N-linked oligosaccharides with a sulfated carbohydrate structure type HNK-1 (SO4-3-GlcUABeta1,3GalBeta1,4GlcNAc).1 Publication
    O-glycosylated.1 Publication

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiP70232.
    PRIDEiP70232.

    PTM databases

    PhosphoSiteiP70232.

    Expressioni

    Tissue specificityi

    Expressed in the brain, in the cerebellum and in the spinal cord. Detected in the retina and the optic nerve. Expressed in neurons and glial cells in the central nervous system and by Schwann cells in the peripheral nervous system.3 Publications

    Developmental stagei

    Not detectable in the forebrain at E11, weakly detectable at E13 with highest detection at E18 to postnatal day 7. Down-regulated at postnatal day 15 and further reduced in four-week-old animals.3 Publications

    Gene expression databases

    CleanExiMM_CHL1.
    GenevestigatoriP70232.

    Interactioni

    Subunit structurei

    May interact with L1CAM. May interact with ITGB1/ITGA1 heterodimer and ITGB1/ITGA2 heterodimer as well as with ANK3.

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    Cntn6Q9JMB85EBI-7703109,EBI-7703151
    PtpraP180524EBI-7703109,EBI-6597520

    Protein-protein interaction databases

    BioGridi198702. 1 interaction.
    IntActiP70232. 3 interactions.
    MINTiMINT-4106227.

    Structurei

    3D structure databases

    ProteinModelPortaliP70232.
    SMRiP70232. Positions 31-1002.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini26 – 10831058ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini1105 – 1209105CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei1084 – 110421HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini35 – 12490Ig-like C2-type 1Add
    BLAST
    Domaini128 – 22396Ig-like C2-type 2Add
    BLAST
    Domaini235 – 32894Ig-like C2-type 3Add
    BLAST
    Domaini331 – 41787Ig-like C2-type 4Add
    BLAST
    Domaini423 – 51088Ig-like C2-type 5Add
    BLAST
    Domaini515 – 60793Ig-like C2-type 6Add
    BLAST
    Domaini614 – 70996Fibronectin type-III 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini714 – 80794Fibronectin type-III 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini812 – 914103Fibronectin type-III 3PROSITE-ProRule annotationAdd
    BLAST
    Domaini918 – 101598Fibronectin type-III 4PROSITE-ProRule annotationAdd
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi555 – 5584DGEA
    Motifi1182 – 11865FIG[AQ]Y

    Domaini

    The FIG[AQ]Y motif seems to be an ankyrin recruitment region.
    The DGEA motif seems to be a recognition site for integrin.

    Sequence similaritiesi

    Contains 4 fibronectin type-III domains.PROSITE-ProRule annotation

    Keywords - Domaini

    Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG256023.
    GeneTreeiENSGT00690000101868.
    HOGENOMiHOG000231380.
    HOVERGENiHBG000144.
    KOiK06758.
    OMAiYVRYQFR.
    OrthoDBiEOG7R56RM.
    TreeFamiTF351098.

    Family and domain databases

    Gene3Di2.60.40.10. 10 hits.
    InterProiIPR003961. Fibronectin_type3.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR013098. Ig_I-set.
    IPR003599. Ig_sub.
    IPR003598. Ig_sub2.
    IPR026966. Neurofascin/L1/NrCAM_C.
    [Graphical view]
    PfamiPF13882. Bravo_FIGEY. 1 hit.
    PF00041. fn3. 4 hits.
    PF07679. I-set. 4 hits.
    [Graphical view]
    SMARTiSM00060. FN3. 4 hits.
    SM00409. IG. 2 hits.
    SM00408. IGc2. 3 hits.
    [Graphical view]
    SUPFAMiSSF49265. SSF49265. 2 hits.
    PROSITEiPS50853. FN3. 4 hits.
    PS50835. IG_LIKE. 6 hits.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P70232-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MMELPLCGRG LILSLIFLLL KLSAAEIPLS VQQVPTIVKQ SYVQVAFPFD     50
    EYFQIECEAK GNPEPIFSWT KDDKPFDLSD PRIIAANNSG TFKIPNEGHI 100
    SHFQGKYRCF ASNRLGTAVS EEIEFIVPGV PKFPKEKIEP IDVEEGDSIV 150
    LPCNPPKGLP PLHIYWMNIE LEHIEQDERV YMSQRGDLYF ANVEENDSRN 200
    DYCCFAAFPK LRTIVQKMPM KLTVNSSNSI KQRKPKLLLP PAQMGSLSAK 250
    TVLKGDTLLL ECFAEGLPTP HIQWSKPGSE LPEGRATIEV HEKTLKIENI 300
    SYQDRGNYRC TANNLLGKAS HDFHVTVEEP PRWKKKPQSA VYSTGSSGIL 350
    LCEAEGEPQP TIKWRLNGLP IEKHPFPGDF MFPREISFTN LLPNHTGVYQ 400
    CEASNIHGTI LANANIDVID VIPLIKTKNE ENYATVVGYS AFLHCEYFAS 450
    PKATVVWEVA DETHPLEGDR YHTHENGTLE IYRTTEEDAG SYSCWVDNAM 500
    GKAVITANLD IRNATKLRVS PKNPRIPKSH VLELYCESQC DSHLKHSLKL 550
    SWSKDGEAFE MNGTEDGRIV IDGAYLTISN ITAEDQGVYS CSAQTSLDST 600
    SEKTQVTVLG VPDPPGNLHL SERQNRSVRL SWEAGDDHNS KISEYIVEFE 650
    GNREEPGKWE ELTRVQGEET DVVLSLAPYV RYQFRVTAVN EVGRSHASLP 700
    SDHHETPPAA PDKNPQNIRV QASQPKEMII KWEPLKSMEQ NGPGLEYKVS 750
    WKPQGAPEEW EEEIVTNHTL RVMTPTVYAP YDVKVQAINQ LGSSPDPQPV 800
    TLYSGEDYPS TAPVIQRVDV MNSTLVKVTW SSIPKETVHG LLRGYQINWW 850
    KTKSLLDGRT HPKEVNILRF SGQRNSGMVP SLDPFSEFHL TVLAYNSKGA 900
    GPESEPYIFQ TPEGVPEQPS FLKVIKVDKD TATLSWGLPK KLNGNLTGYL 950
    LQYQIINDTY ELGELNEINV TTPSKSSWHL SNLNSTTKYK FYLRACTSRG 1000
    CGKPISEEGA TLGEGSKGIR KITEGVNVTQ KIHPVEVLVP GAEHIVHLMT 1050
    KNWGDNDSIF QDVIETRGRE YAGLYDDIST QGWFIGLMCA IALLTLILLT 1100
    ICFVKRNRGG KYSVKEKEDL HPDPEVQSAK DETFGEYSDS DEKPLKGSLR 1150
    SLNRNMQPTE SADSLVEYGE GDQSIFNEDG SFIGAYTGAK EKGSVESNGS 1200
    STATFPLRA 1209
    Length:1,209
    Mass (Da):135,074
    Last modified:October 3, 2012 - v2
    Checksum:i2C689475920AB84C
    GO
    Isoform 2 (identifier: P70232-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         227-227: S → LKHASDSSSSTEICSQA
         1016-1070: SKGIRKITEGVNVTQKIHPVEVLVPGAEHIVHLMTKNWGDNDSIFQDVIETRGRE → K
         1138-1209: SDSDEKPLKG...SSTATFPLRA → RKMVLKQKLL...LRYFSSNKHT

    Show »
    Length:1,150
    Mass (Da):129,001
    Checksum:i6CF6C082529C7A99
    GO

    Sequence cautioni

    The sequence BAC30699.1 differs from that shown. Reason: Frameshift at positions 616, 624, 631, 632, 642 and 645.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti50 – 501D → G in BAC35247. (PubMed:16141072)Curated
    Sequence conflicti77 – 771D → E in CAC88131. (PubMed:12391163)Curated
    Sequence conflicti425 – 4251I → V in BAC35247. (PubMed:16141072)Curated
    Sequence conflicti602 – 6021E → K in CAA63972. (PubMed:8921253)Curated
    Sequence conflicti612 – 6121P → G in CAA63972. (PubMed:8921253)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei227 – 2271S → LKHASDSSSSTEICSQA in isoform 2. 1 PublicationVSP_020083
    Alternative sequencei1016 – 107055SKGIR…TRGRE → K in isoform 2. 1 PublicationVSP_020084Add
    BLAST
    Alternative sequencei1138 – 120972SDSDE…FPLRA → RKMVLKQKLLSWSSSRGRTF YSCTKNTLFDGSSVDMKTLQ PLRYFSSNKHT in isoform 2. 1 PublicationVSP_020085Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X94310 mRNA. Translation: CAA63972.1.
    AK040765 mRNA. Translation: BAC30699.1. Frameshift.
    AK048639 mRNA. Translation: BAC33405.1.
    AK053039 mRNA. Translation: BAC35247.2.
    AC153595 Genomic DNA. No translation available.
    AC153598 Genomic DNA. No translation available.
    AC161824 Genomic DNA. No translation available.
    CH466523 Genomic DNA. Translation: EDK99388.1.
    BC131670 mRNA. Translation: AAI31671.1.
    BC131671 mRNA. Translation: AAI31672.1.
    AJ319655, AJ319656, AJ319657 Genomic DNA. Translation: CAC88131.1.
    CCDSiCCDS39582.1. [P70232-1]
    PIRiT42718.
    RefSeqiNP_031723.2. NM_007697.2. [P70232-1]
    XP_006505535.1. XM_006505472.1. [P70232-1]
    UniGeneiMm.251288.

    Genome annotation databases

    EnsembliENSMUST00000066905; ENSMUSP00000063933; ENSMUSG00000030077. [P70232-1]
    GeneIDi12661.
    KEGGimmu:12661.
    UCSCiuc009dcj.1. mouse.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X94310 mRNA. Translation: CAA63972.1 .
    AK040765 mRNA. Translation: BAC30699.1 . Frameshift.
    AK048639 mRNA. Translation: BAC33405.1 .
    AK053039 mRNA. Translation: BAC35247.2 .
    AC153595 Genomic DNA. No translation available.
    AC153598 Genomic DNA. No translation available.
    AC161824 Genomic DNA. No translation available.
    CH466523 Genomic DNA. Translation: EDK99388.1 .
    BC131670 mRNA. Translation: AAI31671.1 .
    BC131671 mRNA. Translation: AAI31672.1 .
    AJ319655 , AJ319656 , AJ319657 Genomic DNA. Translation: CAC88131.1 .
    CCDSi CCDS39582.1. [P70232-1 ]
    PIRi T42718.
    RefSeqi NP_031723.2. NM_007697.2. [P70232-1 ]
    XP_006505535.1. XM_006505472.1. [P70232-1 ]
    UniGenei Mm.251288.

    3D structure databases

    ProteinModelPortali P70232.
    SMRi P70232. Positions 31-1002.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 198702. 1 interaction.
    IntActi P70232. 3 interactions.
    MINTi MINT-4106227.

    PTM databases

    PhosphoSitei P70232.

    Proteomic databases

    PaxDbi P70232.
    PRIDEi P70232.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000066905 ; ENSMUSP00000063933 ; ENSMUSG00000030077 . [P70232-1 ]
    GeneIDi 12661.
    KEGGi mmu:12661.
    UCSCi uc009dcj.1. mouse.

    Organism-specific databases

    CTDi 10752.
    MGIi MGI:1098266. Chl1.

    Phylogenomic databases

    eggNOGi NOG256023.
    GeneTreei ENSGT00690000101868.
    HOGENOMi HOG000231380.
    HOVERGENi HBG000144.
    KOi K06758.
    OMAi YVRYQFR.
    OrthoDBi EOG7R56RM.
    TreeFami TF351098.

    Enzyme and pathway databases

    Reactomei REACT_198267. CHL1 interactions.

    Miscellaneous databases

    NextBioi 281890.
    PROi P70232.
    SOURCEi Search...

    Gene expression databases

    CleanExi MM_CHL1.
    Genevestigatori P70232.

    Family and domain databases

    Gene3Di 2.60.40.10. 10 hits.
    InterProi IPR003961. Fibronectin_type3.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR013098. Ig_I-set.
    IPR003599. Ig_sub.
    IPR003598. Ig_sub2.
    IPR026966. Neurofascin/L1/NrCAM_C.
    [Graphical view ]
    Pfami PF13882. Bravo_FIGEY. 1 hit.
    PF00041. fn3. 4 hits.
    PF07679. I-set. 4 hits.
    [Graphical view ]
    SMARTi SM00060. FN3. 4 hits.
    SM00409. IG. 2 hits.
    SM00408. IGc2. 3 hits.
    [Graphical view ]
    SUPFAMi SSF49265. SSF49265. 2 hits.
    PROSITEi PS50853. FN3. 4 hits.
    PS50835. IG_LIKE. 6 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Structural features of a close homologue of L1 (CHL1) in the mouse: a new member of the L1 family of neural recognition molecules."
      Holm J., Hillenbrand R., Steuber V., Bartsch U., Moos M., Luebbert H., Montag D., Schachner M.
      Eur. J. Neurosci. 8:1613-1629(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, GLYCOSYLATION, DEVELOPMENTAL STAGE.
    2. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-425 AND 666-1209 (ISOFORM 1).
      Strain: C57BL/6J.
      Tissue: Aorta, Head and Vein.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    4. Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.
      Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
    6. "Misguided axonal projections, neural cell adhesion molecule 180 mRNA upregulation, and altered behavior in mice deficient for the close homolog of L1."
      Montag-Sallaz M., Schachner M., Montag D.
      Mol. Cell. Biol. 22:7967-7981(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-129, FUNCTION, DISRUPTION PHENOTYPE.
      Strain: 129/Sv.
    7. "The close homologue of the neural adhesion molecule L1 (CHL1): patterns of expression and promotion of neurite outgrowth by heterophilic interactions."
      Hillenbrand R., Molthagen M., Montag D., Schachner M.
      Eur. J. Neurosci. 11:813-826(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, DEVELOPMENTAL STAGE, INTERACTION WITH L1CAM, TISSUE SPECIFICITY.
    8. "Prevention of neuronal cell death by neural adhesion molecules L1 and CHL1."
      Chen S., Mantei N., Dong L., Schachner M.
      J. Neurobiol. 38:428-439(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.
    9. "Mice deficient for the close homologue of the neural adhesion cell L1 (CHL1) display alterations in emotional reactivity and motor coordination."
      Pratte M., Rougon G., Schachner M., Jamon M.
      Behav. Brain Res. 147:31-39(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, DISRUPTION PHENOTYPE.
    10. "CALL interrupted in a patient with non-specific mental retardation: gene dosage-dependent alteration of murine brain development and behavior."
      Frints S.G.M., Marynen P., Hartmann D., Fryns J.-P., Steyaert J., Schachner M., Rolf B., Craessaerts K., Snellinx A., Hollanders K., D'Hooge R., De Deyn P.P., Froyen G.
      Hum. Mol. Genet. 12:1463-1474(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, DISRUPTION PHENOTYPE.
    11. "Close homolog of L1 is an enhancer of integrin-mediated cell migration."
      Buhusi M., Midkiff B.R., Gates A.M., Richter M., Schachner M., Maness P.F.
      J. Biol. Chem. 278:25024-25031(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH ANK3; ITGB1/ITGA1 HETERODIMER AND ITGB1/ITGA2 HETERODIMER, MOTIFS, MUTAGENESIS OF 555-ASP--ALA-558 AND TYR-1186.
    12. "Ectodomain shedding of the neural recognition molecule CHL1 by the metalloprotease-disintegrin ADAM8 promotes neurite outgrowth and suppresses neuronal cell death."
      Naus S., Richter M., Wildeboer D., Moss M., Schachner M., Bartsch J.W.
      J. Biol. Chem. 279:16083-16090(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, CLEAVAGE BY ADAM8.
    13. "Close homolog of L1 modulates area-specific neuronal positioning and dendrite orientation in the cerebral cortex."
      Demyanenko G.P., Schachner M., Anton E., Schmid R., Feng G., Sanes J., Maness P.F.
      Neuron 44:423-437(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
    14. "Enhanced perisomatic inhibition and impaired long-term potentiation in the CA1 region of juvenile CHL1-deficient mice."
      Nikonenko A.G., Sun M., Lepsveridze E., Apostolova I., Petrova I., Irintchev A., Dityatev A., Schachner M.
      Eur. J. Neurosci. 23:1839-1852(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, DISRUPTION PHENOTYPE.

    Entry informationi

    Entry nameiCHL1_MOUSE
    AccessioniPrimary (citable) accession number: P70232
    Secondary accession number(s): A2RRK1
    , Q8BS24, Q8C6W0, Q8C823, Q8VBY7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 25, 2006
    Last sequence update: October 3, 2012
    Last modified: October 1, 2014
    This is version 118 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3