Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P70232

- NCHL1_MOUSE

UniProt

P70232 - NCHL1_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Neural cell adhesion molecule L1-like protein

Gene

Chl1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Extracellular matrix and cell adhesion protein that plays a role in nervous system development and in synaptic plasticity. Both soluble and membranous forms promote neurite outgrowth of cerebellar and hippocampal neurons and suppress neuronal cell death. Plays a role in neuronal positioning of pyramidal neurons as well as in regulation of both the number of interneurons and the efficacy of GABAergic synapses. May play a role in regulating cell migration in nerve regeneration and cortical development. Potentiates integrin-dependent cell migration towards extracellular matrix proteins. Recruits ANK3 to the plasma membrane.9 Publications

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei753 – 7542Cleavage; by ADAM8
Sitei1040 – 10412Cleavage; by ADAM8

GO - Molecular functioni

  1. protease binding Source: BHF-UCL

GO - Biological processi

  1. adult locomotory behavior Source: MGI
  2. axon guidance Source: MGI
  3. axon regeneration Source: Ensembl
  4. cell adhesion Source: UniProtKB-KW
  5. cognition Source: MGI
  6. exploration behavior Source: MGI
  7. negative regulation of neuron apoptotic process Source: BHF-UCL
  8. neuron migration Source: MGI
  9. neuron projection development Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Cell adhesion, Differentiation, Neurogenesis

Enzyme and pathway databases

ReactomeiREACT_198267. CHL1 interactions.

Names & Taxonomyi

Protein namesi
Recommended name:
Neural cell adhesion molecule L1-like protein
Alternative name(s):
Cell adhesion molecule with homology to L1CAM
Chl1-like protein
Close homolog of L1
Cleaved into the following chain:
Gene namesi
Name:Chl1
Synonyms:Call
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 6

Organism-specific databases

MGIiMGI:1098266. Chl1.

Subcellular locationi

Cell membrane; Single-pass type I membrane protein
Note: Soluble forms produced by cleavage/shedding also exist.

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini26 – 10831058ExtracellularSequence AnalysisAdd
BLAST
Transmembranei1084 – 110421HelicalSequence AnalysisAdd
BLAST
Topological domaini1105 – 1209105CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. apical part of cell Source: MGI
  2. dendrite Source: MGI
  3. integral component of membrane Source: UniProtKB-KW
  4. plasma membrane Source: Reactome
  5. proteinaceous extracellular matrix Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Extracellular matrix, Membrane, Secreted

Pathology & Biotechi

Disruption phenotypei

Mice exhibit misguided axonal projections and aberrant axonal connectivity. They show alterations of hippocampal fiber organization and olfactory axon projections. Their exploratory behavior in novel environments is altered suggesting deficits in information processing and in attention. They also display signs of decreased stress and are more sociable and less aggressive. Heterozygous mice exhibit half levels of CHL1 expression in the hippocampus compared to their wild-type littermates, reflecting a gene dosage effect.4 Publications

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi555 – 5584DGEA → AGEV: Inhibition of migration potentiation. 1 Publication
Mutagenesisi1186 – 11861Y → A: Inhibition of migration potentiation. 1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2525Sequence AnalysisAdd
BLAST
Chaini26 – 12091184Neural cell adhesion molecule L1-like proteinPRO_0000247897Add
BLAST
Chaini26 – ?Processed neural cell adhesion molecule L1-like proteinSequence AnalysisPRO_0000314778

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi57 ↔ 109PROSITE-ProRule annotation
Glycosylationi87 – 871N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi153 ↔ 204PROSITE-ProRule annotation
Glycosylationi225 – 2251N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi262 ↔ 310PROSITE-ProRule annotation
Glycosylationi299 – 2991N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi352 ↔ 401PROSITE-ProRule annotation
Disulfide bondi445 ↔ 494PROSITE-ProRule annotation
Glycosylationi476 – 4761N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi536 ↔ 591PROSITE-ProRule annotation
Glycosylationi562 – 5621N-linked (GlcNAc...)Sequence Analysis
Glycosylationi580 – 5801N-linked (GlcNAc...)Sequence Analysis
Glycosylationi767 – 7671N-linked (GlcNAc...)Sequence Analysis
Glycosylationi822 – 8221N-linked (GlcNAc...)Sequence Analysis
Glycosylationi945 – 9451N-linked (GlcNAc...)Sequence Analysis
Glycosylationi1027 – 10271N-linked (GlcNAc...)Sequence Analysis

Post-translational modificationi

Cleavage by metalloprotease ADAM8 in the extracellular part generates 2 soluble forms (125 kDa and 165 kDa) in vitro and is inhibited by metalloprotease inhibitors. In brain extracts, these two soluble forms are also present and are dramatically reduced in mice lacking ADAM8.
N-glycosylated. Contains N-linked oligosaccharides with a sulfated carbohydrate structure type HNK-1 (SO4-3-GlcUABeta1,3GalBeta1,4GlcNAc).1 Publication
O-glycosylated.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQBiP70232.
PaxDbiP70232.
PRIDEiP70232.

PTM databases

PhosphoSiteiP70232.

Expressioni

Tissue specificityi

Expressed in the brain, in the cerebellum and in the spinal cord. Detected in the retina and the optic nerve. Expressed in neurons and glial cells in the central nervous system and by Schwann cells in the peripheral nervous system.3 Publications

Developmental stagei

Not detectable in the forebrain at E11, weakly detectable at E13 with highest detection at E18 to postnatal day 7. Down-regulated at postnatal day 15 and further reduced in four-week-old animals.3 Publications

Gene expression databases

CleanExiMM_CHL1.
GenevestigatoriP70232.

Interactioni

Subunit structurei

May interact with L1CAM. May interact with ITGB1/ITGA1 heterodimer and ITGB1/ITGA2 heterodimer as well as with ANK3.

Binary interactionsi

WithEntry#Exp.IntActNotes
Cntn6Q9JMB85EBI-7703109,EBI-7703151
PtpraP180524EBI-7703109,EBI-6597520

Protein-protein interaction databases

BioGridi198702. 1 interaction.
IntActiP70232. 3 interactions.
MINTiMINT-4106227.

Structurei

3D structure databases

ProteinModelPortaliP70232.
SMRiP70232. Positions 31-1002.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini35 – 12490Ig-like C2-type 1Add
BLAST
Domaini128 – 22396Ig-like C2-type 2Add
BLAST
Domaini235 – 32894Ig-like C2-type 3Add
BLAST
Domaini331 – 41787Ig-like C2-type 4Add
BLAST
Domaini423 – 51088Ig-like C2-type 5Add
BLAST
Domaini515 – 60793Ig-like C2-type 6Add
BLAST
Domaini614 – 70996Fibronectin type-III 1PROSITE-ProRule annotationAdd
BLAST
Domaini714 – 80794Fibronectin type-III 2PROSITE-ProRule annotationAdd
BLAST
Domaini812 – 914103Fibronectin type-III 3PROSITE-ProRule annotationAdd
BLAST
Domaini918 – 101598Fibronectin type-III 4PROSITE-ProRule annotationAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi555 – 5584DGEA
Motifi1182 – 11865FIG[AQ]Y

Domaini

The FIG[AQ]Y motif seems to be an ankyrin recruitment region.
The DGEA motif seems to be a recognition site for integrin.

Sequence similaritiesi

Contains 4 fibronectin type-III domains.PROSITE-ProRule annotation

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG256023.
GeneTreeiENSGT00760000118840.
HOGENOMiHOG000231380.
HOVERGENiHBG000144.
InParanoidiP70232.
KOiK06758.
OMAiYVRYQFR.
OrthoDBiEOG7R56RM.
TreeFamiTF351098.

Family and domain databases

Gene3Di2.60.40.10. 10 hits.
InterProiIPR003961. Fibronectin_type3.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR026966. Neurofascin/L1/NrCAM_C.
[Graphical view]
PfamiPF13882. Bravo_FIGEY. 1 hit.
PF00041. fn3. 4 hits.
PF07679. I-set. 4 hits.
[Graphical view]
SMARTiSM00060. FN3. 4 hits.
SM00409. IG. 2 hits.
SM00408. IGc2. 3 hits.
[Graphical view]
SUPFAMiSSF49265. SSF49265. 2 hits.
PROSITEiPS50853. FN3. 4 hits.
PS50835. IG_LIKE. 6 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P70232-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MMELPLCGRG LILSLIFLLL KLSAAEIPLS VQQVPTIVKQ SYVQVAFPFD
60 70 80 90 100
EYFQIECEAK GNPEPIFSWT KDDKPFDLSD PRIIAANNSG TFKIPNEGHI
110 120 130 140 150
SHFQGKYRCF ASNRLGTAVS EEIEFIVPGV PKFPKEKIEP IDVEEGDSIV
160 170 180 190 200
LPCNPPKGLP PLHIYWMNIE LEHIEQDERV YMSQRGDLYF ANVEENDSRN
210 220 230 240 250
DYCCFAAFPK LRTIVQKMPM KLTVNSSNSI KQRKPKLLLP PAQMGSLSAK
260 270 280 290 300
TVLKGDTLLL ECFAEGLPTP HIQWSKPGSE LPEGRATIEV HEKTLKIENI
310 320 330 340 350
SYQDRGNYRC TANNLLGKAS HDFHVTVEEP PRWKKKPQSA VYSTGSSGIL
360 370 380 390 400
LCEAEGEPQP TIKWRLNGLP IEKHPFPGDF MFPREISFTN LLPNHTGVYQ
410 420 430 440 450
CEASNIHGTI LANANIDVID VIPLIKTKNE ENYATVVGYS AFLHCEYFAS
460 470 480 490 500
PKATVVWEVA DETHPLEGDR YHTHENGTLE IYRTTEEDAG SYSCWVDNAM
510 520 530 540 550
GKAVITANLD IRNATKLRVS PKNPRIPKSH VLELYCESQC DSHLKHSLKL
560 570 580 590 600
SWSKDGEAFE MNGTEDGRIV IDGAYLTISN ITAEDQGVYS CSAQTSLDST
610 620 630 640 650
SEKTQVTVLG VPDPPGNLHL SERQNRSVRL SWEAGDDHNS KISEYIVEFE
660 670 680 690 700
GNREEPGKWE ELTRVQGEET DVVLSLAPYV RYQFRVTAVN EVGRSHASLP
710 720 730 740 750
SDHHETPPAA PDKNPQNIRV QASQPKEMII KWEPLKSMEQ NGPGLEYKVS
760 770 780 790 800
WKPQGAPEEW EEEIVTNHTL RVMTPTVYAP YDVKVQAINQ LGSSPDPQPV
810 820 830 840 850
TLYSGEDYPS TAPVIQRVDV MNSTLVKVTW SSIPKETVHG LLRGYQINWW
860 870 880 890 900
KTKSLLDGRT HPKEVNILRF SGQRNSGMVP SLDPFSEFHL TVLAYNSKGA
910 920 930 940 950
GPESEPYIFQ TPEGVPEQPS FLKVIKVDKD TATLSWGLPK KLNGNLTGYL
960 970 980 990 1000
LQYQIINDTY ELGELNEINV TTPSKSSWHL SNLNSTTKYK FYLRACTSRG
1010 1020 1030 1040 1050
CGKPISEEGA TLGEGSKGIR KITEGVNVTQ KIHPVEVLVP GAEHIVHLMT
1060 1070 1080 1090 1100
KNWGDNDSIF QDVIETRGRE YAGLYDDIST QGWFIGLMCA IALLTLILLT
1110 1120 1130 1140 1150
ICFVKRNRGG KYSVKEKEDL HPDPEVQSAK DETFGEYSDS DEKPLKGSLR
1160 1170 1180 1190 1200
SLNRNMQPTE SADSLVEYGE GDQSIFNEDG SFIGAYTGAK EKGSVESNGS

STATFPLRA
Length:1,209
Mass (Da):135,074
Last modified:October 3, 2012 - v2
Checksum:i2C689475920AB84C
GO
Isoform 2 (identifier: P70232-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     227-227: S → LKHASDSSSSTEICSQA
     1016-1070: SKGIRKITEGVNVTQKIHPVEVLVPGAEHIVHLMTKNWGDNDSIFQDVIETRGRE → K
     1138-1209: SDSDEKPLKG...SSTATFPLRA → RKMVLKQKLL...LRYFSSNKHT

Show »
Length:1,150
Mass (Da):129,001
Checksum:i6CF6C082529C7A99
GO

Sequence cautioni

The sequence BAC30699.1 differs from that shown. Reason: Frameshift at positions 616, 624, 631, 632, 642 and 645. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti50 – 501D → G in BAC35247. (PubMed:16141072)Curated
Sequence conflicti77 – 771D → E in CAC88131. (PubMed:12391163)Curated
Sequence conflicti425 – 4251I → V in BAC35247. (PubMed:16141072)Curated
Sequence conflicti602 – 6021E → K in CAA63972. (PubMed:8921253)Curated
Sequence conflicti612 – 6121P → G in CAA63972. (PubMed:8921253)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei227 – 2271S → LKHASDSSSSTEICSQA in isoform 2. 1 PublicationVSP_020083
Alternative sequencei1016 – 107055SKGIR…TRGRE → K in isoform 2. 1 PublicationVSP_020084Add
BLAST
Alternative sequencei1138 – 120972SDSDE…FPLRA → RKMVLKQKLLSWSSSRGRTF YSCTKNTLFDGSSVDMKTLQ PLRYFSSNKHT in isoform 2. 1 PublicationVSP_020085Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X94310 mRNA. Translation: CAA63972.1.
AK040765 mRNA. Translation: BAC30699.1. Frameshift.
AK048639 mRNA. Translation: BAC33405.1.
AK053039 mRNA. Translation: BAC35247.2.
AC153595 Genomic DNA. No translation available.
AC153598 Genomic DNA. No translation available.
AC161824 Genomic DNA. No translation available.
CH466523 Genomic DNA. Translation: EDK99388.1.
BC131670 mRNA. Translation: AAI31671.1.
BC131671 mRNA. Translation: AAI31672.1.
AJ319655, AJ319656, AJ319657 Genomic DNA. Translation: CAC88131.1.
CCDSiCCDS39582.1. [P70232-1]
PIRiT42718.
RefSeqiNP_031723.2. NM_007697.2. [P70232-1]
XP_006505535.1. XM_006505472.1. [P70232-1]
UniGeneiMm.251288.

Genome annotation databases

EnsembliENSMUST00000066905; ENSMUSP00000063933; ENSMUSG00000030077. [P70232-1]
GeneIDi12661.
KEGGimmu:12661.
UCSCiuc009dcj.1. mouse.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X94310 mRNA. Translation: CAA63972.1 .
AK040765 mRNA. Translation: BAC30699.1 . Frameshift.
AK048639 mRNA. Translation: BAC33405.1 .
AK053039 mRNA. Translation: BAC35247.2 .
AC153595 Genomic DNA. No translation available.
AC153598 Genomic DNA. No translation available.
AC161824 Genomic DNA. No translation available.
CH466523 Genomic DNA. Translation: EDK99388.1 .
BC131670 mRNA. Translation: AAI31671.1 .
BC131671 mRNA. Translation: AAI31672.1 .
AJ319655 , AJ319656 , AJ319657 Genomic DNA. Translation: CAC88131.1 .
CCDSi CCDS39582.1. [P70232-1 ]
PIRi T42718.
RefSeqi NP_031723.2. NM_007697.2. [P70232-1 ]
XP_006505535.1. XM_006505472.1. [P70232-1 ]
UniGenei Mm.251288.

3D structure databases

ProteinModelPortali P70232.
SMRi P70232. Positions 31-1002.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 198702. 1 interaction.
IntActi P70232. 3 interactions.
MINTi MINT-4106227.

PTM databases

PhosphoSitei P70232.

Proteomic databases

MaxQBi P70232.
PaxDbi P70232.
PRIDEi P70232.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000066905 ; ENSMUSP00000063933 ; ENSMUSG00000030077 . [P70232-1 ]
GeneIDi 12661.
KEGGi mmu:12661.
UCSCi uc009dcj.1. mouse.

Organism-specific databases

CTDi 10752.
MGIi MGI:1098266. Chl1.

Phylogenomic databases

eggNOGi NOG256023.
GeneTreei ENSGT00760000118840.
HOGENOMi HOG000231380.
HOVERGENi HBG000144.
InParanoidi P70232.
KOi K06758.
OMAi YVRYQFR.
OrthoDBi EOG7R56RM.
TreeFami TF351098.

Enzyme and pathway databases

Reactomei REACT_198267. CHL1 interactions.

Miscellaneous databases

NextBioi 281890.
PROi P70232.
SOURCEi Search...

Gene expression databases

CleanExi MM_CHL1.
Genevestigatori P70232.

Family and domain databases

Gene3Di 2.60.40.10. 10 hits.
InterProi IPR003961. Fibronectin_type3.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR026966. Neurofascin/L1/NrCAM_C.
[Graphical view ]
Pfami PF13882. Bravo_FIGEY. 1 hit.
PF00041. fn3. 4 hits.
PF07679. I-set. 4 hits.
[Graphical view ]
SMARTi SM00060. FN3. 4 hits.
SM00409. IG. 2 hits.
SM00408. IGc2. 3 hits.
[Graphical view ]
SUPFAMi SSF49265. SSF49265. 2 hits.
PROSITEi PS50853. FN3. 4 hits.
PS50835. IG_LIKE. 6 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Structural features of a close homologue of L1 (CHL1) in the mouse: a new member of the L1 family of neural recognition molecules."
    Holm J., Hillenbrand R., Steuber V., Bartsch U., Moos M., Luebbert H., Montag D., Schachner M.
    Eur. J. Neurosci. 8:1613-1629(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, GLYCOSYLATION, DEVELOPMENTAL STAGE.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-425 AND 666-1209 (ISOFORM 1).
    Strain: C57BL/6J.
    Tissue: Aorta, Head and Vein.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  4. Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.
    Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
  6. "Misguided axonal projections, neural cell adhesion molecule 180 mRNA upregulation, and altered behavior in mice deficient for the close homolog of L1."
    Montag-Sallaz M., Schachner M., Montag D.
    Mol. Cell. Biol. 22:7967-7981(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-129, FUNCTION, DISRUPTION PHENOTYPE.
    Strain: 129/Sv.
  7. "The close homologue of the neural adhesion molecule L1 (CHL1): patterns of expression and promotion of neurite outgrowth by heterophilic interactions."
    Hillenbrand R., Molthagen M., Montag D., Schachner M.
    Eur. J. Neurosci. 11:813-826(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, DEVELOPMENTAL STAGE, INTERACTION WITH L1CAM, TISSUE SPECIFICITY.
  8. "Prevention of neuronal cell death by neural adhesion molecules L1 and CHL1."
    Chen S., Mantei N., Dong L., Schachner M.
    J. Neurobiol. 38:428-439(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  9. "Mice deficient for the close homologue of the neural adhesion cell L1 (CHL1) display alterations in emotional reactivity and motor coordination."
    Pratte M., Rougon G., Schachner M., Jamon M.
    Behav. Brain Res. 147:31-39(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, DISRUPTION PHENOTYPE.
  10. "CALL interrupted in a patient with non-specific mental retardation: gene dosage-dependent alteration of murine brain development and behavior."
    Frints S.G.M., Marynen P., Hartmann D., Fryns J.-P., Steyaert J., Schachner M., Rolf B., Craessaerts K., Snellinx A., Hollanders K., D'Hooge R., De Deyn P.P., Froyen G.
    Hum. Mol. Genet. 12:1463-1474(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, DISRUPTION PHENOTYPE.
  11. "Close homolog of L1 is an enhancer of integrin-mediated cell migration."
    Buhusi M., Midkiff B.R., Gates A.M., Richter M., Schachner M., Maness P.F.
    J. Biol. Chem. 278:25024-25031(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH ANK3; ITGB1/ITGA1 HETERODIMER AND ITGB1/ITGA2 HETERODIMER, MOTIFS, MUTAGENESIS OF 555-ASP--ALA-558 AND TYR-1186.
  12. "Ectodomain shedding of the neural recognition molecule CHL1 by the metalloprotease-disintegrin ADAM8 promotes neurite outgrowth and suppresses neuronal cell death."
    Naus S., Richter M., Wildeboer D., Moss M., Schachner M., Bartsch J.W.
    J. Biol. Chem. 279:16083-16090(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, CLEAVAGE BY ADAM8.
  13. "Close homolog of L1 modulates area-specific neuronal positioning and dendrite orientation in the cerebral cortex."
    Demyanenko G.P., Schachner M., Anton E., Schmid R., Feng G., Sanes J., Maness P.F.
    Neuron 44:423-437(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
  14. "Enhanced perisomatic inhibition and impaired long-term potentiation in the CA1 region of juvenile CHL1-deficient mice."
    Nikonenko A.G., Sun M., Lepsveridze E., Apostolova I., Petrova I., Irintchev A., Dityatev A., Schachner M.
    Eur. J. Neurosci. 23:1839-1852(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, DISRUPTION PHENOTYPE.

Entry informationi

Entry nameiNCHL1_MOUSE
AccessioniPrimary (citable) accession number: P70232
Secondary accession number(s): A2RRK1
, Q8BS24, Q8C6W0, Q8C823, Q8VBY7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 25, 2006
Last sequence update: October 3, 2012
Last modified: November 26, 2014
This is version 120 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3