Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Neural cell adhesion molecule L1-like protein

Gene

Chl1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Extracellular matrix and cell adhesion protein that plays a role in nervous system development and in synaptic plasticity. Both soluble and membranous forms promote neurite outgrowth of cerebellar and hippocampal neurons and suppress neuronal cell death. Plays a role in neuronal positioning of pyramidal neurons as well as in regulation of both the number of interneurons and the efficacy of GABAergic synapses. May play a role in regulating cell migration in nerve regeneration and cortical development. Potentiates integrin-dependent cell migration towards extracellular matrix proteins. Recruits ANK3 to the plasma membrane.9 Publications

GO - Molecular functioni

  • protease binding Source: BHF-UCL

GO - Biological processi

  • adult locomotory behavior Source: MGI
  • axon guidance Source: MGI
  • axon regeneration Source: Ensembl
  • cell adhesion Source: UniProtKB-KW
  • cognition Source: MGI
  • exploration behavior Source: MGI
  • negative regulation of neuron apoptotic process Source: BHF-UCL
  • neuron migration Source: MGI
  • neuron projection development Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Cell adhesion, Differentiation, Neurogenesis

Enzyme and pathway databases

ReactomeiR-MMU-447041. CHL1 interactions.

Names & Taxonomyi

Protein namesi
Recommended name:
Neural cell adhesion molecule L1-like protein
Alternative name(s):
Cell adhesion molecule with homology to L1CAM
Chl1-like protein
Close homolog of L1
Cleaved into the following chain:
Gene namesi
Name:Chl1
Synonyms:Call
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 6

Organism-specific databases

MGIiMGI:1098266. Chl1.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini26 – 1083ExtracellularSequence analysisAdd BLAST1058
Transmembranei1084 – 1104HelicalSequence analysisAdd BLAST21
Topological domaini1105 – 1209CytoplasmicSequence analysisAdd BLAST105

GO - Cellular componenti

  • apical part of cell Source: MGI
  • dendrite Source: MGI
  • extracellular exosome Source: MGI
  • integral component of membrane Source: UniProtKB-KW
  • plasma membrane Source: Reactome
  • proteinaceous extracellular matrix Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Extracellular matrix, Membrane, Secreted

Pathology & Biotechi

Disruption phenotypei

Mice exhibit misguided axonal projections and aberrant axonal connectivity. They show alterations of hippocampal fiber organization and olfactory axon projections. Their exploratory behavior in novel environments is altered suggesting deficits in information processing and in attention. They also display signs of decreased stress and are more sociable and less aggressive. Heterozygous mice exhibit half levels of CHL1 expression in the hippocampus compared to their wild-type littermates, reflecting a gene dosage effect.4 Publications

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi555 – 558DGEA → AGEV: Inhibition of migration potentiation. 1 Publication4
Mutagenesisi1186Y → A: Inhibition of migration potentiation. 1 Publication1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 25Sequence analysisAdd BLAST25
ChainiPRO_000024789726 – 1209Neural cell adhesion molecule L1-like proteinAdd BLAST1184
ChainiPRO_000031477826 – ?Processed neural cell adhesion molecule L1-like proteinSequence analysis

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi57 ↔ 109PROSITE-ProRule annotation
Glycosylationi87N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi153 ↔ 204PROSITE-ProRule annotation
Glycosylationi225N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi262 ↔ 310PROSITE-ProRule annotation
Glycosylationi299N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi352 ↔ 401PROSITE-ProRule annotation
Disulfide bondi445 ↔ 494PROSITE-ProRule annotation
Glycosylationi476N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi536 ↔ 591PROSITE-ProRule annotation
Glycosylationi562N-linked (GlcNAc...)Sequence analysis1
Glycosylationi580N-linked (GlcNAc...)Sequence analysis1
Glycosylationi767N-linked (GlcNAc...)Sequence analysis1
Glycosylationi822N-linked (GlcNAc...)Sequence analysis1
Glycosylationi945N-linked (GlcNAc...)Sequence analysis1
Glycosylationi1027N-linked (GlcNAc...)Sequence analysis1
Modified residuei1148PhosphoserineCombined sources1
Modified residuei1161PhosphoserineCombined sources1
Modified residuei1181PhosphoserineCombined sources1

Post-translational modificationi

Cleavage by metalloprotease ADAM8 in the extracellular part generates 2 soluble forms (125 kDa and 165 kDa) in vitro and is inhibited by metalloprotease inhibitors. In brain extracts, these two soluble forms are also present and are dramatically reduced in mice lacking ADAM8.
N-glycosylated. Contains N-linked oligosaccharides with a sulfated carbohydrate structure type HNK-1 (SO4-3-GlcUABeta1,3GalBeta1,4GlcNAc).1 Publication
O-glycosylated.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei753 – 754Cleavage; by ADAM82
Sitei1040 – 1041Cleavage; by ADAM82

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiP70232.
PaxDbiP70232.
PeptideAtlasiP70232.
PRIDEiP70232.

PTM databases

iPTMnetiP70232.
PhosphoSitePlusiP70232.

Expressioni

Tissue specificityi

Expressed in the brain, in the cerebellum and in the spinal cord. Detected in the retina and the optic nerve. Expressed in neurons and glial cells in the central nervous system and by Schwann cells in the peripheral nervous system.3 Publications

Developmental stagei

Not detectable in the forebrain at E11, weakly detectable at E13 with highest detection at E18 to postnatal day 7. Down-regulated at postnatal day 15 and further reduced in four-week-old animals.3 Publications

Gene expression databases

BgeeiENSMUSG00000030077.
CleanExiMM_CHL1.
ExpressionAtlasiP70232. baseline and differential.
GenevisibleiP70232. MM.

Interactioni

Subunit structurei

May interact with L1CAM. May interact with ITGB1/ITGA1 heterodimer and ITGB1/ITGA2 heterodimer as well as with ANK3.

Binary interactionsi

WithEntry#Exp.IntActNotes
Cntn6Q9JMB85EBI-7703109,EBI-7703151
PtpraP180524EBI-7703109,EBI-6597520

GO - Molecular functioni

  • protease binding Source: BHF-UCL

Protein-protein interaction databases

BioGridi198702. 1 interactor.
IntActiP70232. 3 interactors.
MINTiMINT-4106227.
STRINGi10090.ENSMUSP00000063933.

Structurei

3D structure databases

ProteinModelPortaliP70232.
SMRiP70232.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini35 – 124Ig-like C2-type 1Add BLAST90
Domaini128 – 223Ig-like C2-type 2Add BLAST96
Domaini235 – 328Ig-like C2-type 3Add BLAST94
Domaini331 – 417Ig-like C2-type 4Add BLAST87
Domaini423 – 510Ig-like C2-type 5Add BLAST88
Domaini515 – 607Ig-like C2-type 6Add BLAST93
Domaini614 – 709Fibronectin type-III 1PROSITE-ProRule annotationAdd BLAST96
Domaini714 – 807Fibronectin type-III 2PROSITE-ProRule annotationAdd BLAST94
Domaini812 – 914Fibronectin type-III 3PROSITE-ProRule annotationAdd BLAST103
Domaini918 – 1015Fibronectin type-III 4PROSITE-ProRule annotationAdd BLAST98

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi555 – 558DGEA4
Motifi1182 – 1186FIG[AQ]Y5

Domaini

The FIG[AQ]Y motif seems to be an ankyrin recruitment region.
The DGEA motif seems to be a recognition site for integrin.

Sequence similaritiesi

Contains 4 fibronectin type-III domains.PROSITE-ProRule annotation

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3513. Eukaryota.
ENOG410XSVG. LUCA.
GeneTreeiENSGT00760000118840.
HOGENOMiHOG000231380.
HOVERGENiHBG000144.
InParanoidiP70232.
KOiK06758.
OMAiYVRYQFR.
OrthoDBiEOG091G00LY.
TreeFamiTF351098.

Family and domain databases

CDDicd00063. FN3. 4 hits.
Gene3Di2.60.40.10. 10 hits.
InterProiIPR003961. FN3_dom.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR026966. Neurofascin/L1/NrCAM_C.
[Graphical view]
PfamiPF13882. Bravo_FIGEY. 1 hit.
PF00041. fn3. 4 hits.
PF07679. I-set. 2 hits.
PF13895. Ig_2. 1 hit.
[Graphical view]
SMARTiSM00060. FN3. 4 hits.
SM00409. IG. 5 hits.
SM00408. IGc2. 5 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 6 hits.
SSF49265. SSF49265. 2 hits.
PROSITEiPS50853. FN3. 4 hits.
PS50835. IG_LIKE. 6 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P70232-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MMELPLCGRG LILSLIFLLL KLSAAEIPLS VQQVPTIVKQ SYVQVAFPFD
60 70 80 90 100
EYFQIECEAK GNPEPIFSWT KDDKPFDLSD PRIIAANNSG TFKIPNEGHI
110 120 130 140 150
SHFQGKYRCF ASNRLGTAVS EEIEFIVPGV PKFPKEKIEP IDVEEGDSIV
160 170 180 190 200
LPCNPPKGLP PLHIYWMNIE LEHIEQDERV YMSQRGDLYF ANVEENDSRN
210 220 230 240 250
DYCCFAAFPK LRTIVQKMPM KLTVNSSNSI KQRKPKLLLP PAQMGSLSAK
260 270 280 290 300
TVLKGDTLLL ECFAEGLPTP HIQWSKPGSE LPEGRATIEV HEKTLKIENI
310 320 330 340 350
SYQDRGNYRC TANNLLGKAS HDFHVTVEEP PRWKKKPQSA VYSTGSSGIL
360 370 380 390 400
LCEAEGEPQP TIKWRLNGLP IEKHPFPGDF MFPREISFTN LLPNHTGVYQ
410 420 430 440 450
CEASNIHGTI LANANIDVID VIPLIKTKNE ENYATVVGYS AFLHCEYFAS
460 470 480 490 500
PKATVVWEVA DETHPLEGDR YHTHENGTLE IYRTTEEDAG SYSCWVDNAM
510 520 530 540 550
GKAVITANLD IRNATKLRVS PKNPRIPKSH VLELYCESQC DSHLKHSLKL
560 570 580 590 600
SWSKDGEAFE MNGTEDGRIV IDGAYLTISN ITAEDQGVYS CSAQTSLDST
610 620 630 640 650
SEKTQVTVLG VPDPPGNLHL SERQNRSVRL SWEAGDDHNS KISEYIVEFE
660 670 680 690 700
GNREEPGKWE ELTRVQGEET DVVLSLAPYV RYQFRVTAVN EVGRSHASLP
710 720 730 740 750
SDHHETPPAA PDKNPQNIRV QASQPKEMII KWEPLKSMEQ NGPGLEYKVS
760 770 780 790 800
WKPQGAPEEW EEEIVTNHTL RVMTPTVYAP YDVKVQAINQ LGSSPDPQPV
810 820 830 840 850
TLYSGEDYPS TAPVIQRVDV MNSTLVKVTW SSIPKETVHG LLRGYQINWW
860 870 880 890 900
KTKSLLDGRT HPKEVNILRF SGQRNSGMVP SLDPFSEFHL TVLAYNSKGA
910 920 930 940 950
GPESEPYIFQ TPEGVPEQPS FLKVIKVDKD TATLSWGLPK KLNGNLTGYL
960 970 980 990 1000
LQYQIINDTY ELGELNEINV TTPSKSSWHL SNLNSTTKYK FYLRACTSRG
1010 1020 1030 1040 1050
CGKPISEEGA TLGEGSKGIR KITEGVNVTQ KIHPVEVLVP GAEHIVHLMT
1060 1070 1080 1090 1100
KNWGDNDSIF QDVIETRGRE YAGLYDDIST QGWFIGLMCA IALLTLILLT
1110 1120 1130 1140 1150
ICFVKRNRGG KYSVKEKEDL HPDPEVQSAK DETFGEYSDS DEKPLKGSLR
1160 1170 1180 1190 1200
SLNRNMQPTE SADSLVEYGE GDQSIFNEDG SFIGAYTGAK EKGSVESNGS

STATFPLRA
Length:1,209
Mass (Da):135,074
Last modified:October 3, 2012 - v2
Checksum:i2C689475920AB84C
GO
Isoform 2 (identifier: P70232-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     227-227: S → LKHASDSSSSTEICSQA
     1016-1070: SKGIRKITEGVNVTQKIHPVEVLVPGAEHIVHLMTKNWGDNDSIFQDVIETRGRE → K
     1138-1209: SDSDEKPLKG...SSTATFPLRA → RKMVLKQKLL...LRYFSSNKHT

Show »
Length:1,150
Mass (Da):129,001
Checksum:i6CF6C082529C7A99
GO

Sequence cautioni

The sequence BAC30699 differs from that shown. Reason: Frameshift at positions 616, 624, 631, 632, 642 and 645.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti50D → G in BAC35247 (PubMed:16141072).Curated1
Sequence conflicti77D → E in CAC88131 (PubMed:12391163).Curated1
Sequence conflicti425I → V in BAC35247 (PubMed:16141072).Curated1
Sequence conflicti602E → K in CAA63972 (PubMed:8921253).Curated1
Sequence conflicti612P → G in CAA63972 (PubMed:8921253).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_020083227S → LKHASDSSSSTEICSQA in isoform 2. 1 Publication1
Alternative sequenceiVSP_0200841016 – 1070SKGIR…TRGRE → K in isoform 2. 1 PublicationAdd BLAST55
Alternative sequenceiVSP_0200851138 – 1209SDSDE…FPLRA → RKMVLKQKLLSWSSSRGRTF YSCTKNTLFDGSSVDMKTLQ PLRYFSSNKHT in isoform 2. 1 PublicationAdd BLAST72

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X94310 mRNA. Translation: CAA63972.1.
AK040765 mRNA. Translation: BAC30699.1. Frameshift.
AK048639 mRNA. Translation: BAC33405.1.
AK053039 mRNA. Translation: BAC35247.2.
AC153595 Genomic DNA. No translation available.
AC153598 Genomic DNA. No translation available.
AC161824 Genomic DNA. No translation available.
CH466523 Genomic DNA. Translation: EDK99388.1.
BC131670 mRNA. Translation: AAI31671.1.
BC131671 mRNA. Translation: AAI31672.1.
AJ319655, AJ319656, AJ319657 Genomic DNA. Translation: CAC88131.1.
CCDSiCCDS39582.1. [P70232-1]
PIRiT42718.
RefSeqiNP_031723.2. NM_007697.2. [P70232-1]
XP_006505535.1. XM_006505472.3. [P70232-1]
XP_017176864.1. XM_017321375.1. [P70232-1]
XP_017176865.1. XM_017321376.1. [P70232-1]
UniGeneiMm.251288.

Genome annotation databases

EnsembliENSMUST00000066905; ENSMUSP00000063933; ENSMUSG00000030077. [P70232-1]
ENSMUST00000203830; ENSMUSP00000144758; ENSMUSG00000030077. [P70232-1]
ENSMUST00000203912; ENSMUSP00000145026; ENSMUSG00000030077. [P70232-2]
GeneIDi12661.
KEGGimmu:12661.
UCSCiuc009dcj.1. mouse. [P70232-1]
uc009dck.1. mouse. [P70232-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X94310 mRNA. Translation: CAA63972.1.
AK040765 mRNA. Translation: BAC30699.1. Frameshift.
AK048639 mRNA. Translation: BAC33405.1.
AK053039 mRNA. Translation: BAC35247.2.
AC153595 Genomic DNA. No translation available.
AC153598 Genomic DNA. No translation available.
AC161824 Genomic DNA. No translation available.
CH466523 Genomic DNA. Translation: EDK99388.1.
BC131670 mRNA. Translation: AAI31671.1.
BC131671 mRNA. Translation: AAI31672.1.
AJ319655, AJ319656, AJ319657 Genomic DNA. Translation: CAC88131.1.
CCDSiCCDS39582.1. [P70232-1]
PIRiT42718.
RefSeqiNP_031723.2. NM_007697.2. [P70232-1]
XP_006505535.1. XM_006505472.3. [P70232-1]
XP_017176864.1. XM_017321375.1. [P70232-1]
XP_017176865.1. XM_017321376.1. [P70232-1]
UniGeneiMm.251288.

3D structure databases

ProteinModelPortaliP70232.
SMRiP70232.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi198702. 1 interactor.
IntActiP70232. 3 interactors.
MINTiMINT-4106227.
STRINGi10090.ENSMUSP00000063933.

PTM databases

iPTMnetiP70232.
PhosphoSitePlusiP70232.

Proteomic databases

MaxQBiP70232.
PaxDbiP70232.
PeptideAtlasiP70232.
PRIDEiP70232.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000066905; ENSMUSP00000063933; ENSMUSG00000030077. [P70232-1]
ENSMUST00000203830; ENSMUSP00000144758; ENSMUSG00000030077. [P70232-1]
ENSMUST00000203912; ENSMUSP00000145026; ENSMUSG00000030077. [P70232-2]
GeneIDi12661.
KEGGimmu:12661.
UCSCiuc009dcj.1. mouse. [P70232-1]
uc009dck.1. mouse. [P70232-2]

Organism-specific databases

CTDi10752.
MGIiMGI:1098266. Chl1.

Phylogenomic databases

eggNOGiKOG3513. Eukaryota.
ENOG410XSVG. LUCA.
GeneTreeiENSGT00760000118840.
HOGENOMiHOG000231380.
HOVERGENiHBG000144.
InParanoidiP70232.
KOiK06758.
OMAiYVRYQFR.
OrthoDBiEOG091G00LY.
TreeFamiTF351098.

Enzyme and pathway databases

ReactomeiR-MMU-447041. CHL1 interactions.

Miscellaneous databases

PROiP70232.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000030077.
CleanExiMM_CHL1.
ExpressionAtlasiP70232. baseline and differential.
GenevisibleiP70232. MM.

Family and domain databases

CDDicd00063. FN3. 4 hits.
Gene3Di2.60.40.10. 10 hits.
InterProiIPR003961. FN3_dom.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR026966. Neurofascin/L1/NrCAM_C.
[Graphical view]
PfamiPF13882. Bravo_FIGEY. 1 hit.
PF00041. fn3. 4 hits.
PF07679. I-set. 2 hits.
PF13895. Ig_2. 1 hit.
[Graphical view]
SMARTiSM00060. FN3. 4 hits.
SM00409. IG. 5 hits.
SM00408. IGc2. 5 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 6 hits.
SSF49265. SSF49265. 2 hits.
PROSITEiPS50853. FN3. 4 hits.
PS50835. IG_LIKE. 6 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiNCHL1_MOUSE
AccessioniPrimary (citable) accession number: P70232
Secondary accession number(s): A2RRK1
, Q8BS24, Q8C6W0, Q8C823, Q8VBY7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 25, 2006
Last sequence update: October 3, 2012
Last modified: November 30, 2016
This is version 138 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.