Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Kinesin-associated protein 3

Gene

Kifap3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Involved in tethering the chromosomes to the spindle pole and in chromosome movement. Binds to the tail domain of the KIF3A/KIF3B heterodimer to form a heterotrimeric KIF3 complex and may regulate the membrane binding of this complex.

GO - Molecular functioni

GO - Biological processi

  • membrane organization Source: Reactome
  • microtubule-based movement Source: Reactome
  • microtubule-based process Source: UniProtKB
  • negative regulation of apoptotic process Source: MGI
  • negative regulation of cell proliferation Source: MGI
  • positive regulation of calcium-dependent cell-cell adhesion Source: MGI
  • protein localization Source: MGI
Complete GO annotation...

Enzyme and pathway databases

ReactomeiR-MMU-1445148. Translocation of GLUT4 to the plasma membrane.
R-MMU-2132295. MHC class II antigen presentation.
R-MMU-5620924. Intraflagellar transport.
R-MMU-6811434. COPI-dependent Golgi-to-ER retrograde traffic.
R-MMU-983189. Kinesins.

Names & Taxonomyi

Protein namesi
Recommended name:
Kinesin-associated protein 3
Short name:
KAP-3
Short name:
KAP3
Gene namesi
Name:Kifap3
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 1

Organism-specific databases

MGIiMGI:107566. Kifap3.

Subcellular locationi

GO - Cellular componenti

  • axoneme Source: MGI
  • centrosome Source: MGI
  • ciliary basal body Source: MGI
  • condensed nuclear chromosome Source: MGI
  • cytosol Source: Reactome
  • endoplasmic reticulum Source: MGI
  • extracellular exosome Source: MGI
  • Golgi apparatus Source: MGI
  • kinesin II complex Source: UniProtKB
  • microtubule cytoskeleton Source: MGI
  • periciliary membrane compartment Source: MGI
  • photoreceptor connecting cilium Source: MGI
  • spindle microtubule Source: Ensembl
Complete GO annotation...

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 793793Kinesin-associated protein 3PRO_0000084303Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei60 – 601PhosphoserineCombined sources

Post-translational modificationi

Phosphorylated on tyrosine residues by SRC in vitro; this reduces the binding affinity of the protein for RAP1GDS1.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiP70188.
MaxQBiP70188.
PaxDbiP70188.
PeptideAtlasiP70188.
PRIDEiP70188.

PTM databases

iPTMnetiP70188.
PhosphoSiteiP70188.

Expressioni

Gene expression databases

BgeeiP70188.
CleanExiMM_KIFAP3.
GenevisibleiP70188. MM.

Interactioni

Subunit structurei

Interacts with SMC3 subunit of the cohesin complex (By similarity). Heterotrimer of KIFAP3, KIF3A and KIF3B. Interacts with RAP1GDS1/SMG GDS.By similarity

GO - Molecular functioni

Protein-protein interaction databases

BioGridi200951. 5 interactions.
IntActiP70188. 5 interactions.
MINTiMINT-8077979.
STRINGi10090.ENSMUSP00000076830.

Structurei

3D structure databases

ProteinModelPortaliP70188.
SMRiP70188. Positions 634-660.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati333 – 37341ARM 1Add
BLAST
Repeati374 – 41239ARM 2Add
BLAST
Repeati494 – 53340ARM 3Add
BLAST
Repeati578 – 62043ARM 4Add
BLAST
Repeati621 – 66242ARM 5Add
BLAST

Sequence similaritiesi

Contains 5 ARM repeats.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG1222. Eukaryota.
ENOG410XT8I. LUCA.
GeneTreeiENSGT00390000003574.
HOGENOMiHOG000012952.
HOVERGENiHBG052257.
InParanoidiP70188.
OMAiFYSADGI.
OrthoDBiEOG7B5WVK.
PhylomeDBiP70188.
TreeFamiTF314964.

Family and domain databases

Gene3Di1.25.10.10. 2 hits.
InterProiIPR011989. ARM-like.
IPR016024. ARM-type_fold.
IPR000225. Armadillo.
IPR008658. KAP3.
[Graphical view]
PANTHERiPTHR15605. PTHR15605. 1 hit.
SMARTiSM00185. ARM. 3 hits.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 1 hit.
PROSITEiPS50176. ARM_REPEAT. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform KAP3A (identifier: P70188-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQGEDARYLK RKVKGGNIDV HPSEKALIVQ YEVEATILGE MGDPMLGERK
60 70 80 90 100
ECQKIIRLKS LNANTDITSL ARKVVEECKL IHPSKLSEVE QLLYYLQNRR
110 120 130 140 150
DSLPGKEKKE KSSKPKDPPP FEGMEIDEVA NINDMDEYIE LLYEDIPDKV
160 170 180 190 200
RGSALILQLA RNPDNLEELL LNETALGALA RVLREDWKQS VELATNIIYI
210 220 230 240 250
FFCFSSFSHF HGLITHYKIG ALCMNIIDHE LKRHELWQEE LSKKKKAVDE
260 270 280 290 300
DLENQTLRKD YDKTFKKYQG LVVKQEQLLR VALYLLLNLA EDTRTELKMR
310 320 330 340 350
NKNIVHMLVK ALDRDNFELL ILVVSFLKKL SIFMENKNDM VEMDIVEKLV
360 370 380 390 400
KMIPCEHEDL LNITLRLLLN LSFDTGLRNK MVQVGLLPKL TALLGNENYK
410 420 430 440 450
QIAMCVLYHI SMDDRFKSMF AYTDCIPQLM KMLFECSDER IDLELISFCI
460 470 480 490 500
NLAANKRNVQ LICEGNGLKM LMKRALKLKD PLLMKMIRNI SQHDGPTKNL
510 520 530 540 550
FIDYVGDLAA QISSDEEEEF VIECLGTLAN LTIPDLDWEL VLKEYKLVPF
560 570 580 590 600
LKDKLKPGAA EDDLVLEVVI MIGTVSMDDS CAALLAKSGI IPALIELLNA
610 620 630 640 650
QQEDDEFVCQ IIYVFYQMVF HQATRDVIIK ETQAPAYLID LMHDKNNEIR
660 670 680 690 700
KVCDNTLDII AEYDEEWAKK IQSEKFRWHN SQWLEMVESR QLDESEQYLY
710 720 730 740 750
GDDRIEPYIH EGDILERPDL FYNSDGLITS EGAISPDFFN DFHLQNGDVV
760 770 780 790
GQHAFPGSLG MDGFGQPLGI LGRPATAYGF RPDEPYYYSF GSR
Length:793
Mass (Da):91,291
Last modified:February 1, 1997 - v1
Checksum:i38EBC7FD5312DAAB
GO
Isoform KAP3B (identifier: P70188-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     759-793: LGMDGFGQPLGILGRPATAYGFRPDEPYYYSFGSR → TVHPRISKCFASVH

Show »
Length:772
Mass (Da):89,016
Checksum:i9EEDA6161B477ABD
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei759 – 79335LGMDG…SFGSR → TVHPRISKCFASVH in isoform KAP3B. 1 PublicationVSP_003899Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D50366 mRNA. Translation: BAA08901.1.
D50367 mRNA. Translation: BAA08902.1.
BC040362 mRNA. Translation: AAH40362.1.
BC049100 mRNA. Translation: AAH49100.1.
CCDSiCCDS35751.1. [P70188-2]
CCDS78729.1. [P70188-1]
PIRiJC6161.
RefSeqiNP_001292572.1. NM_001305643.1. [P70188-1]
NP_034759.1. NM_010629.3. [P70188-2]
UniGeneiMm.4651.

Genome annotation databases

EnsembliENSMUST00000027877; ENSMUSP00000027877; ENSMUSG00000026585. [P70188-1]
ENSMUST00000077642; ENSMUSP00000076830; ENSMUSG00000026585. [P70188-2]
GeneIDi16579.
KEGGimmu:16579.
UCSCiuc007dho.2. mouse. [P70188-2]
uc007dhp.2. mouse. [P70188-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D50366 mRNA. Translation: BAA08901.1.
D50367 mRNA. Translation: BAA08902.1.
BC040362 mRNA. Translation: AAH40362.1.
BC049100 mRNA. Translation: AAH49100.1.
CCDSiCCDS35751.1. [P70188-2]
CCDS78729.1. [P70188-1]
PIRiJC6161.
RefSeqiNP_001292572.1. NM_001305643.1. [P70188-1]
NP_034759.1. NM_010629.3. [P70188-2]
UniGeneiMm.4651.

3D structure databases

ProteinModelPortaliP70188.
SMRiP70188. Positions 634-660.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi200951. 5 interactions.
IntActiP70188. 5 interactions.
MINTiMINT-8077979.
STRINGi10090.ENSMUSP00000076830.

PTM databases

iPTMnetiP70188.
PhosphoSiteiP70188.

Proteomic databases

EPDiP70188.
MaxQBiP70188.
PaxDbiP70188.
PeptideAtlasiP70188.
PRIDEiP70188.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000027877; ENSMUSP00000027877; ENSMUSG00000026585. [P70188-1]
ENSMUST00000077642; ENSMUSP00000076830; ENSMUSG00000026585. [P70188-2]
GeneIDi16579.
KEGGimmu:16579.
UCSCiuc007dho.2. mouse. [P70188-2]
uc007dhp.2. mouse. [P70188-1]

Organism-specific databases

CTDi22920.
MGIiMGI:107566. Kifap3.

Phylogenomic databases

eggNOGiKOG1222. Eukaryota.
ENOG410XT8I. LUCA.
GeneTreeiENSGT00390000003574.
HOGENOMiHOG000012952.
HOVERGENiHBG052257.
InParanoidiP70188.
OMAiFYSADGI.
OrthoDBiEOG7B5WVK.
PhylomeDBiP70188.
TreeFamiTF314964.

Enzyme and pathway databases

ReactomeiR-MMU-1445148. Translocation of GLUT4 to the plasma membrane.
R-MMU-2132295. MHC class II antigen presentation.
R-MMU-5620924. Intraflagellar transport.
R-MMU-6811434. COPI-dependent Golgi-to-ER retrograde traffic.
R-MMU-983189. Kinesins.

Miscellaneous databases

ChiTaRSiKifap3. mouse.
PROiP70188.
SOURCEiSearch...

Gene expression databases

BgeeiP70188.
CleanExiMM_KIFAP3.
GenevisibleiP70188. MM.

Family and domain databases

Gene3Di1.25.10.10. 2 hits.
InterProiIPR011989. ARM-like.
IPR016024. ARM-type_fold.
IPR000225. Armadillo.
IPR008658. KAP3.
[Graphical view]
PANTHERiPTHR15605. PTHR15605. 1 hit.
SMARTiSM00185. ARM. 3 hits.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 1 hit.
PROSITEiPS50176. ARM_REPEAT. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and characterization of KAP3: a novel kinesin superfamily-associated protein of KIF3A/3B."
    Yamazaki H., Nakata T., Okada Y., Hirokawa N.
    Proc. Natl. Acad. Sci. U.S.A. 93:8443-8448(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA], PROTEIN SEQUENCE OF 86-106; 150-185 AND 486-498, ALTERNATIVE SPLICING.
    Strain: ICR.
    Tissue: Brain.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS KAP3A AND KAP3B).
    Strain: C57BL/6J.
    Tissue: Brain and Eye.
  3. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-60, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain, Brown adipose tissue, Kidney, Lung, Pancreas, Spleen and Testis.

Entry informationi

Entry nameiKIFA3_MOUSE
AccessioniPrimary (citable) accession number: P70188
Secondary accession number(s): P70189, Q6GTS3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 10, 2002
Last sequence update: February 1, 1997
Last modified: July 6, 2016
This is version 130 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.