Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Kinesin-associated protein 3

Gene

Kifap3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Involved in tethering the chromosomes to the spindle pole and in chromosome movement. Binds to the tail domain of the KIF3A/KIF3B heterodimer to form a heterotrimeric KIF3 complex and may regulate the membrane binding of this complex.

GO - Molecular functioni

GO - Biological processi

  • microtubule-based process Source: UniProtKB
  • negative regulation of apoptotic process Source: MGI
  • negative regulation of cell proliferation Source: MGI
  • positive regulation of calcium-dependent cell-cell adhesion Source: MGI
  • protein localization Source: MGI

Enzyme and pathway databases

ReactomeiR-MMU-2132295 MHC class II antigen presentation
R-MMU-5620924 Intraflagellar transport
R-MMU-6811434 COPI-dependent Golgi-to-ER retrograde traffic
R-MMU-983189 Kinesins

Names & Taxonomyi

Protein namesi
Recommended name:
Kinesin-associated protein 3
Short name:
KAP-3
Short name:
KAP3
Gene namesi
Name:Kifap3
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 1

Organism-specific databases

MGIiMGI:107566 Kifap3

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000843031 – 793Kinesin-associated protein 3Add BLAST793

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei60PhosphoserineCombined sources1

Post-translational modificationi

Phosphorylated on tyrosine residues by SRC in vitro; this reduces the binding affinity of the protein for RAP1GDS1.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiP70188
PaxDbiP70188
PeptideAtlasiP70188
PRIDEiP70188

PTM databases

iPTMnetiP70188
PhosphoSitePlusiP70188

Expressioni

Gene expression databases

BgeeiENSMUSG00000026585
CleanExiMM_KIFAP3
GenevisibleiP70188 MM

Interactioni

Subunit structurei

Interacts with SMC3 subunit of the cohesin complex (By similarity). Heterotrimer of KIFAP3, KIF3A and KIF3B. Interacts with RAP1GDS1/SMG GDS.By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
Kif3aP287414EBI-6169443,EBI-6169413

GO - Molecular functioni

Protein-protein interaction databases

BioGridi2009515 interactors.
CORUMiP70188
IntActiP70188 6 interactors.
MINTiP70188
STRINGi10090.ENSMUSP00000076830

Structurei

3D structure databases

ProteinModelPortaliP70188
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati333 – 373ARM 1Add BLAST41
Repeati374 – 412ARM 2Add BLAST39
Repeati494 – 533ARM 3Add BLAST40
Repeati578 – 620ARM 4Add BLAST43
Repeati621 – 662ARM 5Add BLAST42

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG1222 Eukaryota
ENOG410XT8I LUCA
GeneTreeiENSGT00390000003574
HOGENOMiHOG000012952
HOVERGENiHBG052257
InParanoidiP70188
OMAiFMFKSNK
OrthoDBiEOG091G06I3
PhylomeDBiP70188
TreeFamiTF314964

Family and domain databases

Gene3Di1.25.10.102 hits
InterProiView protein in InterPro
IPR011989 ARM-like
IPR016024 ARM-type_fold
IPR000225 Armadillo
IPR008658 KAP3
PANTHERiPTHR15605 PTHR15605, 1 hit
SMARTiView protein in SMART
SM00185 ARM, 3 hits
SUPFAMiSSF48371 SSF48371, 1 hit
PROSITEiView protein in PROSITE
PS50176 ARM_REPEAT, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform KAP3A (identifier: P70188-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQGEDARYLK RKVKGGNIDV HPSEKALIVQ YEVEATILGE MGDPMLGERK
60 70 80 90 100
ECQKIIRLKS LNANTDITSL ARKVVEECKL IHPSKLSEVE QLLYYLQNRR
110 120 130 140 150
DSLPGKEKKE KSSKPKDPPP FEGMEIDEVA NINDMDEYIE LLYEDIPDKV
160 170 180 190 200
RGSALILQLA RNPDNLEELL LNETALGALA RVLREDWKQS VELATNIIYI
210 220 230 240 250
FFCFSSFSHF HGLITHYKIG ALCMNIIDHE LKRHELWQEE LSKKKKAVDE
260 270 280 290 300
DLENQTLRKD YDKTFKKYQG LVVKQEQLLR VALYLLLNLA EDTRTELKMR
310 320 330 340 350
NKNIVHMLVK ALDRDNFELL ILVVSFLKKL SIFMENKNDM VEMDIVEKLV
360 370 380 390 400
KMIPCEHEDL LNITLRLLLN LSFDTGLRNK MVQVGLLPKL TALLGNENYK
410 420 430 440 450
QIAMCVLYHI SMDDRFKSMF AYTDCIPQLM KMLFECSDER IDLELISFCI
460 470 480 490 500
NLAANKRNVQ LICEGNGLKM LMKRALKLKD PLLMKMIRNI SQHDGPTKNL
510 520 530 540 550
FIDYVGDLAA QISSDEEEEF VIECLGTLAN LTIPDLDWEL VLKEYKLVPF
560 570 580 590 600
LKDKLKPGAA EDDLVLEVVI MIGTVSMDDS CAALLAKSGI IPALIELLNA
610 620 630 640 650
QQEDDEFVCQ IIYVFYQMVF HQATRDVIIK ETQAPAYLID LMHDKNNEIR
660 670 680 690 700
KVCDNTLDII AEYDEEWAKK IQSEKFRWHN SQWLEMVESR QLDESEQYLY
710 720 730 740 750
GDDRIEPYIH EGDILERPDL FYNSDGLITS EGAISPDFFN DFHLQNGDVV
760 770 780 790
GQHAFPGSLG MDGFGQPLGI LGRPATAYGF RPDEPYYYSF GSR
Length:793
Mass (Da):91,291
Last modified:February 1, 1997 - v1
Checksum:i38EBC7FD5312DAAB
GO
Isoform KAP3B (identifier: P70188-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     759-793: LGMDGFGQPLGILGRPATAYGFRPDEPYYYSFGSR → TVHPRISKCFASVH

Show »
Length:772
Mass (Da):89,016
Checksum:i9EEDA6161B477ABD
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_003899759 – 793LGMDG…SFGSR → TVHPRISKCFASVH in isoform KAP3B. 1 PublicationAdd BLAST35

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D50366 mRNA Translation: BAA08901.1
D50367 mRNA Translation: BAA08902.1
BC040362 mRNA Translation: AAH40362.1
BC049100 mRNA Translation: AAH49100.1
CCDSiCCDS35751.1 [P70188-2]
CCDS78729.1 [P70188-1]
PIRiJC6161
RefSeqiNP_001292572.1, NM_001305643.1 [P70188-1]
NP_034759.1, NM_010629.3 [P70188-2]
UniGeneiMm.4651

Genome annotation databases

EnsembliENSMUST00000027877; ENSMUSP00000027877; ENSMUSG00000026585 [P70188-1]
ENSMUST00000077642; ENSMUSP00000076830; ENSMUSG00000026585 [P70188-2]
GeneIDi16579
KEGGimmu:16579
UCSCiuc007dho.2 mouse [P70188-2]
uc007dhp.2 mouse [P70188-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiKIFA3_MOUSE
AccessioniPrimary (citable) accession number: P70188
Secondary accession number(s): P70189, Q6GTS3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 10, 2002
Last sequence update: February 1, 1997
Last modified: April 25, 2018
This is version 147 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome