P68502P09862Q7ZZW6MTB_SALALMetallothionein BMT-BmtbSalvelinus alpinusArctic charSalmo alpinusEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiActinopterygiiNeopterygiiTeleosteiProtacanthopterygiiSalmoniformesSalmonidaeSalmoninaeSalvelinusMetallothionein cDNA sequences and gene expression in arctic char (Salvelinus alpinus) following metal and PCB exposure.NUCLEOTIDE SEQUENCEDiscovering single nucleotide polymorphisms in the introns of fish genes.NUCLEOTIDE SEQUENCE [GENOMIC DNA]Metallothioneins have a high content of cysteine residues that bind various heavy metals.Class I metallothioneins contain 2 metal-binding domains: four divalent ions are chelated within cluster A of the alpha domain and are coordinated via cysteinyl thiolate bridges to 11 cysteine ligands. Cluster B, the corresponding region within the beta domain, can ligate three divalent ions to 9 cysteines.Belongs to the metallothionein superfamily. Type 1 family.Metal-bindingMetal-thiolate clustera divalent metal cationin cluster Ba divalent metal cationin cluster Ba divalent metal cationin cluster Ba divalent metal cationin cluster Ba divalent metal cationin cluster Ba divalent metal cationin cluster Ba divalent metal cationin cluster Ba divalent metal cationin cluster Ba divalent metal cationin cluster Ba divalent metal cationin cluster Ba divalent metal cationin cluster Ba divalent metal cationin cluster Ba divalent metal cationin cluster Aa divalent metal cationin cluster Aa divalent metal cationin cluster Aa divalent metal cationin cluster Aa divalent metal cationin cluster Aa divalent metal cationin cluster Aa divalent metal cationin cluster Aa divalent metal cationin cluster Aa divalent metal cationin cluster Aa divalent metal cationin cluster Aa divalent metal cationin cluster Aa divalent metal cationin cluster Aa divalent metal cationin cluster Aa divalent metal cationin cluster Aa divalent metal cationin cluster Aa divalent metal cationin cluster ACDTSCCQLRYQLLSVMDPCECSKTGSCNCGGSCKCSNCACTSCKKSCCPCCPSDCSKCASGCVCKGKTCDTSCCQ
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms Distributed under the Creative Commons Attribution (CC BY 4.0) License