Reviewed,
UniProtKB/Swiss-Prot P68106 (FKB1B_HUMAN)
Last modified
November 3, 2009.
Version 58.
History...
Clusters with 100%,
90%,
50% identity |
Documents (4) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Peptidyl-prolyl cis-trans isomerase FKBP1B Short name=PPIase FKBP1B EC=5.2.1.8 Alternative name(s): FK506-binding protein 1B Short name=FKBP-1B Rotamase Immunophilin FKBP12.6 Short name=12.6 kDa FKBP Short name=FKBP-12.6 h-FKBP-12 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 108 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Associates with the ryanodine receptor (RYR-2) in cardiac muscle sarcoplasmic reticulum and may play a unique physiological role in excitation-contraction coupling in cardiac muscle. There are four molecules of FKBP12.6 per heart muscle RYR. Has the potential to contribute to the immunosuppressive and toxic effects of FK506 and rapamycin. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. |
| Catalytic activity | Peptidylproline (omega=180) = peptidylproline (omega=0). |
| Enzyme regulation | Inhibited by both FK506 and rapamycin. |
| Subcellular location | Cytoplasm By similarity. |
| Tissue specificity | Ubiquitous for both isoforms with highest levels in brain and thymus. |
| Sequence similarities | Belongs to the FKBP-type PPIase family. FKBP1 subfamily. Contains 1 PPIase FKBP-type domain. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P68106-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P68106-2) The sequence of this isoform differs from the canonical sequence as follows: 67-108: MSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE → LGPLSPLPICPHPC |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed By similarity | |||||||||||||||||||||||||
| Chain | 2 – 108 | 107 | Peptidyl-prolyl cis-trans isomerase FKBP1B | PRO_0000075295 | ||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||
| Domain | 20 – 108 | 89 | PPIase FKBP-type | |||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||
| Alternative sequence | 67 – 108 | 42 | MSLGQ…LLNLE → LGPLSPLPICPHPC in isoform 2. | VSP_005184 | ||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||
| Beta strand | 3 – 9 | 7 | ||||||||||||||||||||||||||
| Beta strand | 22 – 31 | 10 | ||||||||||||||||||||||||||
| Beta strand | 36 – 39 | 4 | ||||||||||||||||||||||||||
| Turn | 40 – 44 | 5 | ||||||||||||||||||||||||||
| Beta strand | 47 – 50 | 4 | ||||||||||||||||||||||||||
| Turn | 51 – 54 | 4 | ||||||||||||||||||||||||||
| Helix | 58 – 65 | 8 | ||||||||||||||||||||||||||
| Beta strand | 72 – 77 | 6 | ||||||||||||||||||||||||||
| Helix | 79 – 81 | 3 | ||||||||||||||||||||||||||
| Turn | 82 – 86 | 5 | ||||||||||||||||||||||||||
| Turn | 89 – 91 | 3 | ||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning and expression of a novel human gene that is highly homologous to human FK506-binding protein 12kDa (hFKBP-12) and characterization of two alternatively spliced transcripts." Arakawa H., Nagase H., Hayashi N., Fujiwara T., Ogawa M., Shin S., Nakamura Y. Biochem. Biophys. Res. Commun. 200:836-843(1994) [PubMed: 7513996] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). Tissue: Fetal brain. |
| [2] | "A novel FK506 binding protein can mediate the immunosuppressive effects of FK506 and is associated with the cardiac ryanodine receptor." Lam E., Martin M.M., Timerman A.P., Sabers C., Fleischer S., Lukas T., Abraham R.T., O'Keefe S.J., O'Neill E.A., Wiederrecht G.J. J. Biol. Chem. 270:26511-26522(1995) [PubMed: 7592869] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Brain and Heart muscle. |
| [3] | "FKBP9: an alternative splice variant of the FK506-binding protein FKBP12.6 expressed in the human heart." Seidler T., Kussebi N., Prestle J. Submitted (NOV-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [4] | "Genomic organization, chromosomal localization, and promoter of human gene for FK506-binding protein 12.6." Nakazawa T., Takasawa S., Noguchi N., Nata K., Tohgo A., Mori M., Nakagawara K., Akiyama T., Ikeda T., Yamauchi A., Takahashi I., Yoshikawa T., Okamoto H. Gene 360:55-64(2005) [PubMed: 16122887] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [5] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed: 15815621] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Brain. |
| [8] | "Structure of FKBP12.6 in complex with rapamycin." Deivanayagam C.C., Carson M., Thotakura A., Narayana S.V., Chodavarapu R.S. Acta Crystallogr. D 56:266-271(2000) [PubMed: 10713512] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS). |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| S69815 mRNA. Translation: AAB30684.1. D38037 mRNA. Translation: BAA07232.1. L37086 mRNA. Translation: AAC37581.1. S69800 mRNA. Translation: AAB30685.1. AF322070 mRNA. Translation: AAK11191.1. AB190793 Genomic DNA. Translation: BAE44300.1. AC008073 Genomic DNA. Translation: AAY14663.1. CH471053 Genomic DNA. Translation: EAX00769.1. BC002614 mRNA. Translation: AAH02614.1. | |||||||||||||
| IPI | IPI00073704. IPI00396151. | ||||||||||||
| PIR | JC2188. | ||||||||||||
| RefSeq | NP_004107.1. NP_473374.1. | ||||||||||||
| UniGene | Hs.709461 | ||||||||||||
3D structure databases | |||||||||||||
| |||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| STRING | P68106. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | P68106. | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000380986; ENSP00000370373; ENSG00000119782; Homo sapiens. [Genome view] ENST00000380991; ENSP00000370379; ENSG00000119782; Homo sapiens. [Genome view] ENST00000421839; ENSP00000397444; ENSG00000119782; Homo sapiens. [Genome view] ENST00000438630; ENSP00000416349; ENSG00000119782; Homo sapiens. [Genome view] ENST00000452109; ENSP00000406593; ENSG00000119782; Homo sapiens. [Genome view] | ||||||||||||
| GeneID | 2281. | ||||||||||||
| KEGG | hsa:2281. | ||||||||||||
| UCSC | uc002rer.1. human. uc002res.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 2281. | ||||||||||||
| GeneCards | GC02P024184. | ||||||||||||
| H-InvDB | HIX0001871. | ||||||||||||
| HGNC | HGNC:3712. FKBP1B. | ||||||||||||
| MIM | 600620. gene. | ||||||||||||
| PharmGKB | PA28154. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| HOGENOM | P68106. | ||||||||||||
| HOVERGEN | P68106. | ||||||||||||
| OMA | MNDELQI. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| BRENDA | 5.2.1.8. 247. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | P68106. | ||||||||||||
| CleanEx | HS_FKBP1B. HS_FKBP9. | ||||||||||||
| Genevestigator | P68106. | ||||||||||||
| GermOnline | ENSG00000119782. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR001179. PPIase_FKBP. [Graphical view] | ||||||||||||
| PANTHER | PTHR10516. PPIase_FKBP. 1 hit. | ||||||||||||
| Pfam | PF00254. FKBP_C. 1 hit. [Graphical view] | ||||||||||||
| PROSITE | PS50059. FKBP_PPIASE. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other Resources | |||||||||||||
| NextBio | 9275. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | FKB1B_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P68106 Secondary accession number(s): Q13664 Q9BQ40 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


