Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Peptidyl-prolyl cis-trans isomerase FKBP1B

Gene

FKBP1B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Has the potential to contribute to the immunosuppressive and toxic effects of FK506 and rapamycin. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.

Catalytic activityi

Peptidylproline (omega=180) = peptidylproline (omega=0).

Enzyme regulationi

Inhibited by both FK506 and rapamycin.

GO - Molecular functioni

  • calcium channel inhibitor activity Source: BHF-UCL
  • cyclic nucleotide binding Source: Ensembl
  • FK506 binding Source: BHF-UCL
  • ion channel binding Source: BHF-UCL
  • peptidyl-prolyl cis-trans isomerase activity Source: BHF-UCL
  • signaling receptor binding Source: BHF-UCL

GO - Biological processi

Keywordsi

Molecular functionIsomerase, Rotamase

Enzyme and pathway databases

ReactomeiR-HSA-2672351 Stimuli-sensing channels
R-HSA-5578775 Ion homeostasis

Names & Taxonomyi

Protein namesi
Recommended name:
Peptidyl-prolyl cis-trans isomerase FKBP1B (EC:5.2.1.8)
Short name:
PPIase FKBP1B
Alternative name(s):
12.6 kDa FK506-binding protein
Short name:
12.6 kDa FKBP
Short name:
FKBP-12.6
FK506-binding protein 1B
Short name:
FKBP-1B
Immunophilin FKBP12.6
Rotamase
h-FKBP-12
Gene namesi
Name:FKBP1B
Synonyms:FKBP12.6, FKBP1L, FKBP9, OTK4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000119782.13
HGNCiHGNC:3712 FKBP1B
MIMi600620 gene
neXtProtiNX_P68106

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Sarcoplasmic reticulum

Pathology & Biotechi

Organism-specific databases

DisGeNETi2281
OpenTargetsiENSG00000119782
PharmGKBiPA28154

Chemistry databases

ChEMBLiCHEMBL2430

Polymorphism and mutation databases

BioMutaiFKBP1B
DMDMi61224185

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000752951 – 108Peptidyl-prolyl cis-trans isomerase FKBP1BAdd BLAST108

Proteomic databases

EPDiP68106
MaxQBiP68106
PaxDbiP68106
PeptideAtlasiP68106
PRIDEiP68106

PTM databases

PhosphoSitePlusiP68106

Expressioni

Tissue specificityi

Detected in heart muscle (at protein level). Isoform 1 and isoform 2 are ubiquitous with highest levels in brain and thymus.1 Publication

Gene expression databases

BgeeiENSG00000119782
CleanExiHS_FKBP1B
HS_FKBP9
ExpressionAtlasiP68106 baseline and differential
GenevisibleiP68106 HS

Organism-specific databases

HPAiHPA051798
HPA057830

Interactioni

Subunit structurei

Identified in a complex composed of RYR2, FKBP1B, PKA catalytic subunit, PRKAR2A, AKAP6, and the protein phosphatases PP2A and PP1. Interacts directly with RYR2.1 Publication

Binary interactionsi

Show more details

GO - Molecular functioni

  • ion channel binding Source: BHF-UCL
  • signaling receptor binding Source: BHF-UCL

Protein-protein interaction databases

BioGridi108571, 30 interactors
DIPiDIP-48796N
IntActiP68106, 13 interactors
STRINGi9606.ENSP00000370373

Chemistry databases

BindingDBiP68106

Structurei

Secondary structure

1108
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi3 – 9Combined sources7
Beta strandi22 – 31Combined sources10
Beta strandi36 – 39Combined sources4
Turni40 – 44Combined sources5
Beta strandi47 – 50Combined sources4
Turni51 – 54Combined sources4
Helixi58 – 65Combined sources8
Beta strandi72 – 77Combined sources6
Helixi79 – 81Combined sources3
Turni82 – 86Combined sources5
Turni89 – 91Combined sources3
Beta strandi98 – 108Combined sources11

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1C9HX-ray2.00A2-108[»]
4C02X-ray2.17B1-108[»]
4IQ2X-ray1.70A/B2-108[»]
4IQCX-ray1.90A/B2-108[»]
5HKGX-ray1.50A2-108[»]
5L1Delectron microscopy10.50B/D/F/H2-108[»]
5T15electron microscopy3.80A/F/H/J1-108[»]
5T9Melectron microscopy3.80A/F/H/J1-108[»]
5T9Nelectron microscopy3.80A/F/H/J1-108[»]
5T9Relectron microscopy3.80A/F/H/J1-108[»]
5T9Selectron microscopy3.80A/F/H/J1-108[»]
5T9Velectron microscopy3.80A/F/H/J1-108[»]
5TA3electron microscopy3.80A/F/H/J1-108[»]
5TALelectron microscopy3.80A/F/H/J1-108[»]
5TAMelectron microscopy3.80A/F/H/J1-108[»]
5TANelectron microscopy3.80A/F/H/J1-108[»]
5TAPelectron microscopy3.80A/F/H/J1-108[»]
5TAQelectron microscopy3.80A/F/H/J1-108[»]
5TASelectron microscopy3.80A/F/H/J1-108[»]
5TATelectron microscopy3.80A/F/H/J1-108[»]
5TAUelectron microscopy3.80A/F/H/J1-108[»]
5TAVelectron microscopy3.80A/F/H/J1-108[»]
5TAWelectron microscopy3.80A/F/H/J1-108[»]
5TAXelectron microscopy3.80A/F/H/J1-108[»]
5TAYelectron microscopy3.80A/F/H/J1-108[»]
5TAZelectron microscopy3.80A/F/H/J1-108[»]
5TB0electron microscopy4.40A/F/H/J1-108[»]
5TB1electron microscopy3.80A/F/H/J1-108[»]
5TB2electron microscopy3.80A/F/H/J1-108[»]
5TB3electron microscopy3.80A/F/H/J1-108[»]
5TB4electron microscopy3.80A/F/H/J1-108[»]
ProteinModelPortaliP68106
SMRiP68106
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP68106

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini20 – 108PPIase FKBP-typePROSITE-ProRule annotationAdd BLAST89

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG0544 Eukaryota
COG0545 LUCA
GeneTreeiENSGT00760000119159
HOGENOMiHOG000154887
HOVERGENiHBG051623
InParanoidiP68106
KOiK09568
OMAiWGIMPNS
OrthoDBiEOG091G02W1
PhylomeDBiP68106
TreeFamiTF105291

Family and domain databases

InterProiView protein in InterPro
IPR023566 PPIase_FKBP
IPR001179 PPIase_FKBP_dom
PANTHERiPTHR10516 PTHR10516, 1 hit
PfamiView protein in Pfam
PF00254 FKBP_C, 1 hit
PROSITEiView protein in PROSITE
PS50059 FKBP_PPIASE, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P68106-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGVEIETISP GDGRTFPKKG QTCVVHYTGM LQNGKKFDSS RDRNKPFKFR
60 70 80 90 100
IGKQEVIKGF EEGAAQMSLG QRAKLTCTPD VAYGATGHPG VIPPNATLIF

DVELLNLE
Length:108
Mass (Da):11,783
Last modified:January 23, 2007 - v2
Checksum:iBAC2A25945F63AC4
GO
Isoform 2 (identifier: P68106-2) [UniParc] [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     67-108: MSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE → LGPLSPLPICPHPC

Show »
Length:80
Mass (Da):8,802
Checksum:i99C0A9C743984BA2
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_00518467 – 108MSLGQ…LLNLE → LGPLSPLPICPHPC in isoform 2. 3 PublicationsAdd BLAST42

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
S69815 mRNA Translation: AAB30684.1
D38037 mRNA Translation: BAA07232.1
L37086 mRNA Translation: AAC37581.1
S69800 mRNA Translation: AAB30685.1
AF322070 mRNA Translation: AAK11191.1
AB190793 Genomic DNA Translation: BAE44300.1
AC008073 Genomic DNA Translation: AAY14663.1
CH471053 Genomic DNA Translation: EAX00769.1
BC002614 mRNA Translation: AAH02614.1
CCDSiCCDS1706.1
CCDS33153.1 [P68106-2]
PIRiJC2188
RefSeqiNP_004107.1, NM_004116.4 [P68106-1]
NP_473374.1, NM_054033.3 [P68106-2]
UniGeneiHs.709461

Genome annotation databases

EnsembliENST00000380986; ENSP00000370373; ENSG00000119782 [P68106-1]
ENST00000380991; ENSP00000370379; ENSG00000119782 [P68106-2]
GeneIDi2281
KEGGihsa:2281
UCSCiuc002rer.4 human

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiFKB1B_HUMAN
AccessioniPrimary (citable) accession number: P68106
Secondary accession number(s): Q13664
, Q16645, Q53TM2, Q9BQ40
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 25, 2004
Last sequence update: January 23, 2007
Last modified: May 23, 2018
This is version 142 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health