Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P67812

- SC11A_HUMAN

UniProt

P67812 - SC11A_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Signal peptidase complex catalytic subunit SEC11A

Gene

SEC11A

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.By similarity

Catalytic activityi

Cleavage of hydrophobic, N-terminal signal or leader sequences from secreted and periplasmic proteins.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei56 – 561By similarity

GO - Molecular functioni

  1. serine-type peptidase activity Source: InterPro

GO - Biological processi

  1. cellular protein metabolic process Source: Reactome
  2. gene expression Source: Reactome
  3. regulation of insulin secretion Source: Reactome
  4. signal peptide processing Source: InterPro
  5. SRP-dependent cotranslational protein targeting to membrane Source: Reactome
  6. translation Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protease

Enzyme and pathway databases

ReactomeiREACT_115902. SRP-dependent cotranslational protein targeting to membrane.
REACT_19189. Synthesis, secretion, and deacylation of Ghrelin.
REACT_23824. Synthesis, secretion, and inactivation of Glucose-dependent Insulinotropic Polypeptide (GIP).
REACT_24019. Synthesis, secretion, and inactivation of Glucagon-like Peptide-1 (GLP-1).

Protein family/group databases

MEROPSiS26.009.

Names & Taxonomyi

Protein namesi
Recommended name:
Signal peptidase complex catalytic subunit SEC11A (EC:3.4.21.89)
Alternative name(s):
Endopeptidase SP18
Microsomal signal peptidase 18 kDa subunit
Short name:
SPase 18 kDa subunit
SEC11 homolog A
SEC11-like protein 1
SPC18
Gene namesi
Name:SEC11A
Synonyms:SEC11L1, SPC18, SPCS4A
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 15

Organism-specific databases

HGNCiHGNC:17718. SEC11A.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 1616CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei17 – 3620Helical; Signal-anchor for type II membrane proteinSequence AnalysisAdd
BLAST
Topological domaini37 – 179143LumenalSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. endoplasmic reticulum membrane Source: Reactome
  2. extracellular vesicular exosome Source: UniProt
  3. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Microsome

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162402586.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 179179Signal peptidase complex catalytic subunit SEC11APRO_0000109543Add
BLAST

Proteomic databases

MaxQBiP67812.
PaxDbiP67812.
PRIDEiP67812.

PTM databases

PhosphoSiteiP67812.

Expressioni

Gene expression databases

BgeeiP67812.
CleanExiHS_SEC11A.
ExpressionAtlasiP67812. baseline and differential.
GenevestigatoriP67812.

Interactioni

Subunit structurei

Component of the microsomal signal peptidase complex which consists of five members: SEC11A, SEC11C, SPCS1, SPCS2 and SPCS3.By similarity

Protein-protein interaction databases

BioGridi117037. 8 interactions.
IntActiP67812. 2 interactions.
MINTiMINT-1387363.
STRINGi9606.ENSP00000268220.

Structurei

3D structure databases

ProteinModelPortaliP67812.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the peptidase S26B family.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG0681.
GeneTreeiENSGT00390000015600.
HOGENOMiHOG000111516.
HOVERGENiHBG057279.
InParanoidiP67812.
KOiK13280.
OMAiTKGDNNM.
PhylomeDBiP67812.
TreeFamiTF313648.

Family and domain databases

Gene3Di2.10.109.10. 1 hit.
InterProiIPR019758. Pept_S26A_signal_pept_1_CS.
IPR019756. Pept_S26A_signal_pept_1_Ser-AS.
IPR028360. Peptidase_S24/S26_b-rbn.
IPR019759. Peptidase_S24_S26.
IPR015927. Peptidase_S24_S26A/B/C.
IPR001733. Peptidase_S26B.
[Graphical view]
PANTHERiPTHR10806. PTHR10806. 1 hit.
PfamiPF00717. Peptidase_S24. 1 hit.
[Graphical view]
PRINTSiPR00728. SIGNALPTASE.
SUPFAMiSSF51306. SSF51306. 1 hit.
TIGRFAMsiTIGR02228. sigpep_I_arch. 1 hit.
PROSITEiPS00501. SPASE_I_1. 1 hit.
PS00761. SPASE_I_3. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P67812-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLSLDFLDDV RRMNKRQLYY QVLNFGMIVS SALMIWKGLM VITGSESPIV
60 70 80 90 100
VVLSGSMEPA FHRGDLLFLT NRVEDPIRVG EIVVFRIEGR EIPIVHRVLK
110 120 130 140 150
IHEKQNGHIK FLTKGDNNAV DDRGLYKQGQ HWLEKKDVVG RARGFVPYIG
160 170
IVTILMNDYP KFKYAVLFLL GLFVLVHRE
Length:179
Mass (Da):20,625
Last modified:October 11, 2004 - v1
Checksum:iDFD245A17BA3B47F
GO
Isoform 2 (identifier: P67812-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-26: Missing.

Note: No experimental confirmation available.

Show »
Length:153
Mass (Da):17,408
Checksum:i979DF889F3389CEF
GO
Isoform 3 (identifier: P67812-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     145-179: FVPYIGIVTILMNDYPKFKYAVLFLLGLFVLVHRE → MQFSFCWVYS...YWMFGVDTGL

Note: No experimental confirmation available. Gene prediction based on EST data.

Show »
Length:185
Mass (Da):21,454
Checksum:i00D5E145C05166FA
GO
Isoform 4 (identifier: P67812-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     146-164: VPYIGIVTILMNDYPKFKY → YQENSSVEDRNYLFLILEL
     165-179: Missing.

Note: No experimental confirmation available. Gene prediction based on EST data.

Show »
Length:164
Mass (Da):18,988
Checksum:iFAF0D04553B05F8E
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti19 – 191Y → C in AAD19640. 1 PublicationCurated
Sequence conflicti19 – 191Y → C in AAC36354. (PubMed:15489334)Curated
Sequence conflicti42 – 421I → T in BAD96944. 1 PublicationCurated
Sequence conflicti163 – 1631K → R in AAD19640. 1 PublicationCurated
Sequence conflicti163 – 1631K → R in AAC36354. (PubMed:15489334)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 2626Missing in isoform 2. 1 PublicationVSP_055052Add
BLAST
Alternative sequencei145 – 17935FVPYI…LVHRE → MQFSFCWVYSCWFIVSKKPA LLFLGRCHSFRYWMFGVDTG L in isoform 3. CuratedVSP_055053Add
BLAST
Alternative sequencei146 – 16419VPYIG…PKFKY → YQENSSVEDRNYLFLILEL in isoform 4. CuratedVSP_055054Add
BLAST
Alternative sequencei165 – 17915Missing in isoform 4. CuratedVSP_055055Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF108945 mRNA. Translation: AAD19640.1.
AF061737 mRNA. Translation: AAD17526.1.
AK300693 mRNA. Translation: BAG62376.1.
AK314146 mRNA. Translation: BAG36834.1.
AK223224 mRNA. Translation: BAD96944.1.
AC087732 Genomic DNA. No translation available.
AC115102 Genomic DNA. No translation available.
CH471101 Genomic DNA. Translation: EAX01952.1.
CH471101 Genomic DNA. Translation: EAX01954.1.
CH471101 Genomic DNA. Translation: EAX01956.1.
BC000359 mRNA. Translation: AAH00359.3.
BC014508 mRNA. Translation: AAH14508.1.
AF090315 mRNA. Translation: AAC36354.1.
CCDSiCCDS45340.1. [P67812-1]
CCDS61742.1. [P67812-2]
CCDS61743.1. [P67812-3]
CCDS61744.1. [P67812-4]
RefSeqiNP_001258847.1. NM_001271918.1. [P67812-2]
NP_001258848.1. NM_001271919.1.
NP_001258849.1. NM_001271920.1. [P67812-4]
NP_001258850.1. NM_001271921.1.
NP_001258851.1. NM_001271922.1. [P67812-3]
NP_055115.1. NM_014300.3. [P67812-1]
UniGeneiHs.9534.

Genome annotation databases

EnsembliENST00000268220; ENSP00000268220; ENSG00000140612. [P67812-1]
ENST00000455959; ENSP00000413121; ENSG00000140612. [P67812-2]
ENST00000558134; ENSP00000452697; ENSG00000140612. [P67812-3]
ENST00000560266; ENSP00000452684; ENSG00000140612. [P67812-4]
GeneIDi23478.
KEGGihsa:23478.
UCSCiuc002blb.2. human. [P67812-1]
uc031qtf.1. human.

Polymorphism databases

DMDMi54039634.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF108945 mRNA. Translation: AAD19640.1 .
AF061737 mRNA. Translation: AAD17526.1 .
AK300693 mRNA. Translation: BAG62376.1 .
AK314146 mRNA. Translation: BAG36834.1 .
AK223224 mRNA. Translation: BAD96944.1 .
AC087732 Genomic DNA. No translation available.
AC115102 Genomic DNA. No translation available.
CH471101 Genomic DNA. Translation: EAX01952.1 .
CH471101 Genomic DNA. Translation: EAX01954.1 .
CH471101 Genomic DNA. Translation: EAX01956.1 .
BC000359 mRNA. Translation: AAH00359.3 .
BC014508 mRNA. Translation: AAH14508.1 .
AF090315 mRNA. Translation: AAC36354.1 .
CCDSi CCDS45340.1. [P67812-1 ]
CCDS61742.1. [P67812-2 ]
CCDS61743.1. [P67812-3 ]
CCDS61744.1. [P67812-4 ]
RefSeqi NP_001258847.1. NM_001271918.1. [P67812-2 ]
NP_001258848.1. NM_001271919.1.
NP_001258849.1. NM_001271920.1. [P67812-4 ]
NP_001258850.1. NM_001271921.1.
NP_001258851.1. NM_001271922.1. [P67812-3 ]
NP_055115.1. NM_014300.3. [P67812-1 ]
UniGenei Hs.9534.

3D structure databases

ProteinModelPortali P67812.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 117037. 8 interactions.
IntActi P67812. 2 interactions.
MINTi MINT-1387363.
STRINGi 9606.ENSP00000268220.

Protein family/group databases

MEROPSi S26.009.

PTM databases

PhosphoSitei P67812.

Polymorphism databases

DMDMi 54039634.

Proteomic databases

MaxQBi P67812.
PaxDbi P67812.
PRIDEi P67812.

Protocols and materials databases

DNASUi 23478.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000268220 ; ENSP00000268220 ; ENSG00000140612 . [P67812-1 ]
ENST00000455959 ; ENSP00000413121 ; ENSG00000140612 . [P67812-2 ]
ENST00000558134 ; ENSP00000452697 ; ENSG00000140612 . [P67812-3 ]
ENST00000560266 ; ENSP00000452684 ; ENSG00000140612 . [P67812-4 ]
GeneIDi 23478.
KEGGi hsa:23478.
UCSCi uc002blb.2. human. [P67812-1 ]
uc031qtf.1. human.

Organism-specific databases

CTDi 23478.
GeneCardsi GC15M085212.
HGNCi HGNC:17718. SEC11A.
neXtProti NX_P67812.
PharmGKBi PA162402586.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0681.
GeneTreei ENSGT00390000015600.
HOGENOMi HOG000111516.
HOVERGENi HBG057279.
InParanoidi P67812.
KOi K13280.
OMAi TKGDNNM.
PhylomeDBi P67812.
TreeFami TF313648.

Enzyme and pathway databases

Reactomei REACT_115902. SRP-dependent cotranslational protein targeting to membrane.
REACT_19189. Synthesis, secretion, and deacylation of Ghrelin.
REACT_23824. Synthesis, secretion, and inactivation of Glucose-dependent Insulinotropic Polypeptide (GIP).
REACT_24019. Synthesis, secretion, and inactivation of Glucagon-like Peptide-1 (GLP-1).

Miscellaneous databases

ChiTaRSi SEC11A. human.
GenomeRNAii 23478.
NextBioi 35475221.
PROi P67812.

Gene expression databases

Bgeei P67812.
CleanExi HS_SEC11A.
ExpressionAtlasi P67812. baseline and differential.
Genevestigatori P67812.

Family and domain databases

Gene3Di 2.10.109.10. 1 hit.
InterProi IPR019758. Pept_S26A_signal_pept_1_CS.
IPR019756. Pept_S26A_signal_pept_1_Ser-AS.
IPR028360. Peptidase_S24/S26_b-rbn.
IPR019759. Peptidase_S24_S26.
IPR015927. Peptidase_S24_S26A/B/C.
IPR001733. Peptidase_S26B.
[Graphical view ]
PANTHERi PTHR10806. PTHR10806. 1 hit.
Pfami PF00717. Peptidase_S24. 1 hit.
[Graphical view ]
PRINTSi PR00728. SIGNALPTASE.
SUPFAMi SSF51306. SSF51306. 1 hit.
TIGRFAMsi TIGR02228. sigpep_I_arch. 1 hit.
PROSITEi PS00501. SPASE_I_1. 1 hit.
PS00761. SPASE_I_3. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Human signal peptidase 18 kDa subunit, mRNA complete cds."
    Xie T.P., Wu M.C., Liu X.P., Wang H.J., Liang Y., Guo Y.J.
    Submitted (NOV-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Hepatoma.
  2. "Human microsomal signal peptidase."
    Zhang J., Mao M., Liu T., Wu J., Zhang Q., Fu G., Shen Y., Zhou J., Yu Y., Wang Z., Chen S., Chen Z.
    Submitted (APR-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Neuroblastoma and Skeletal muscle.
  4. Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
    Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Gastric mucosa.
  5. "Analysis of the DNA sequence and duplication history of human chromosome 15."
    Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A.
    , Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.
    Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Colon and Muscle.
  8. Xie T.P., Liu X.P., Wang H.J., Liang Y., Wang H., Qian W.Z., Wei L.X., Liu Y.J., He P., Guo Y.J.
    Submitted (SEP-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 13-179.
    Tissue: Hepatoma.
  9. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  10. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiSC11A_HUMAN
AccessioniPrimary (citable) accession number: P67812
Secondary accession number(s): B2RAD7
, B4DUL4, H0YK72, H0YK83, O75957, P21378, Q53FQ8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 11, 2004
Last sequence update: October 11, 2004
Last modified: November 26, 2014
This is version 98 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. Peptidase families
    Classification of peptidase families and list of entries
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3