Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P67812

- SC11A_HUMAN

UniProt

P67812 - SC11A_HUMAN

Protein

Signal peptidase complex catalytic subunit SEC11A

Gene

SEC11A

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 96 (01 Oct 2014)
      Sequence version 1 (11 Oct 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.By similarity

    Catalytic activityi

    Cleavage of hydrophobic, N-terminal signal or leader sequences from secreted and periplasmic proteins.

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei56 – 561By similarity

    GO - Molecular functioni

    1. serine-type peptidase activity Source: InterPro

    GO - Biological processi

    1. cellular protein metabolic process Source: Reactome
    2. gene expression Source: Reactome
    3. regulation of insulin secretion Source: Reactome
    4. signal peptide processing Source: InterPro
    5. SRP-dependent cotranslational protein targeting to membrane Source: Reactome
    6. translation Source: Reactome

    Keywords - Molecular functioni

    Hydrolase, Protease

    Enzyme and pathway databases

    ReactomeiREACT_115902. SRP-dependent cotranslational protein targeting to membrane.
    REACT_19189. Synthesis, secretion, and deacylation of Ghrelin.
    REACT_23824. Synthesis, secretion, and inactivation of Glucose-dependent Insulinotropic Polypeptide (GIP).
    REACT_24019. Synthesis, secretion, and inactivation of Glucagon-like Peptide-1 (GLP-1).

    Protein family/group databases

    MEROPSiS26.009.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Signal peptidase complex catalytic subunit SEC11A (EC:3.4.21.89)
    Alternative name(s):
    Endopeptidase SP18
    Microsomal signal peptidase 18 kDa subunit
    Short name:
    SPase 18 kDa subunit
    SEC11 homolog A
    SEC11-like protein 1
    SPC18
    Gene namesi
    Name:SEC11A
    Synonyms:SEC11L1, SPC18, SPCS4A
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 15

    Organism-specific databases

    HGNCiHGNC:17718. SEC11A.

    Subcellular locationi

    GO - Cellular componenti

    1. endoplasmic reticulum membrane Source: Reactome
    2. extracellular vesicular exosome Source: UniProt
    3. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Endoplasmic reticulum, Membrane, Microsome

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA162402586.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 179179Signal peptidase complex catalytic subunit SEC11APRO_0000109543Add
    BLAST

    Proteomic databases

    MaxQBiP67812.
    PaxDbiP67812.
    PRIDEiP67812.

    PTM databases

    PhosphoSiteiP67812.

    Expressioni

    Gene expression databases

    ArrayExpressiP67812.
    BgeeiP67812.
    CleanExiHS_SEC11A.
    GenevestigatoriP67812.

    Interactioni

    Subunit structurei

    Component of the microsomal signal peptidase complex which consists of five members: SEC11A, SEC11C, SPCS1, SPCS2 and SPCS3.By similarity

    Protein-protein interaction databases

    BioGridi117037. 7 interactions.
    IntActiP67812. 2 interactions.
    MINTiMINT-1387363.
    STRINGi9606.ENSP00000268220.

    Structurei

    3D structure databases

    ProteinModelPortaliP67812.
    SMRiP67812. Positions 49-146.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 1616CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini37 – 179143LumenalSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei17 – 3620Helical; Signal-anchor for type II membrane proteinSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the peptidase S26B family.Curated

    Keywords - Domaini

    Signal-anchor, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG0681.
    HOGENOMiHOG000111516.
    HOVERGENiHBG057279.
    InParanoidiP67812.
    KOiK13280.
    OMAiTKGDNNM.
    PhylomeDBiP67812.
    TreeFamiTF313648.

    Family and domain databases

    Gene3Di2.10.109.10. 1 hit.
    InterProiIPR019758. Pept_S26A_signal_pept_1_CS.
    IPR019756. Pept_S26A_signal_pept_1_Ser-AS.
    IPR028360. Peptidase_S24/S26_b-rbn.
    IPR019759. Peptidase_S24_S26.
    IPR015927. Peptidase_S24_S26A/B/C.
    IPR001733. Peptidase_S26B.
    [Graphical view]
    PANTHERiPTHR10806. PTHR10806. 1 hit.
    PfamiPF00717. Peptidase_S24. 1 hit.
    [Graphical view]
    PRINTSiPR00728. SIGNALPTASE.
    SUPFAMiSSF51306. SSF51306. 1 hit.
    TIGRFAMsiTIGR02228. sigpep_I_arch. 1 hit.
    PROSITEiPS00501. SPASE_I_1. 1 hit.
    PS00761. SPASE_I_3. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P67812-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MLSLDFLDDV RRMNKRQLYY QVLNFGMIVS SALMIWKGLM VITGSESPIV    50
    VVLSGSMEPA FHRGDLLFLT NRVEDPIRVG EIVVFRIEGR EIPIVHRVLK 100
    IHEKQNGHIK FLTKGDNNAV DDRGLYKQGQ HWLEKKDVVG RARGFVPYIG 150
    IVTILMNDYP KFKYAVLFLL GLFVLVHRE 179
    Length:179
    Mass (Da):20,625
    Last modified:October 11, 2004 - v1
    Checksum:iDFD245A17BA3B47F
    GO
    Isoform 2 (identifier: P67812-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-26: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:153
    Mass (Da):17,408
    Checksum:i979DF889F3389CEF
    GO
    Isoform 3 (identifier: P67812-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         145-179: FVPYIGIVTILMNDYPKFKYAVLFLLGLFVLVHRE → MQFSFCWVYS...YWMFGVDTGL

    Note: No experimental confirmation available. Gene prediction based on EST data.

    Show »
    Length:185
    Mass (Da):21,454
    Checksum:i00D5E145C05166FA
    GO
    Isoform 4 (identifier: P67812-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         146-164: VPYIGIVTILMNDYPKFKY → YQENSSVEDRNYLFLILEL
         165-179: Missing.

    Note: No experimental confirmation available. Gene prediction based on EST data.

    Show »
    Length:164
    Mass (Da):18,988
    Checksum:iFAF0D04553B05F8E
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti19 – 191Y → C in AAD19640. 1 PublicationCurated
    Sequence conflicti19 – 191Y → C in AAC36354. (PubMed:15489334)Curated
    Sequence conflicti42 – 421I → T in BAD96944. 1 PublicationCurated
    Sequence conflicti163 – 1631K → R in AAD19640. 1 PublicationCurated
    Sequence conflicti163 – 1631K → R in AAC36354. (PubMed:15489334)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 2626Missing in isoform 2. 1 PublicationVSP_055052Add
    BLAST
    Alternative sequencei145 – 17935FVPYI…LVHRE → MQFSFCWVYSCWFIVSKKPA LLFLGRCHSFRYWMFGVDTG L in isoform 3. CuratedVSP_055053Add
    BLAST
    Alternative sequencei146 – 16419VPYIG…PKFKY → YQENSSVEDRNYLFLILEL in isoform 4. CuratedVSP_055054Add
    BLAST
    Alternative sequencei165 – 17915Missing in isoform 4. CuratedVSP_055055Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF108945 mRNA. Translation: AAD19640.1.
    AF061737 mRNA. Translation: AAD17526.1.
    AK300693 mRNA. Translation: BAG62376.1.
    AK314146 mRNA. Translation: BAG36834.1.
    AK223224 mRNA. Translation: BAD96944.1.
    AC087732 Genomic DNA. No translation available.
    AC115102 Genomic DNA. No translation available.
    CH471101 Genomic DNA. Translation: EAX01952.1.
    CH471101 Genomic DNA. Translation: EAX01954.1.
    CH471101 Genomic DNA. Translation: EAX01956.1.
    BC000359 mRNA. Translation: AAH00359.3.
    BC014508 mRNA. Translation: AAH14508.1.
    AF090315 mRNA. Translation: AAC36354.1.
    CCDSiCCDS45340.1. [P67812-1]
    CCDS61742.1. [P67812-2]
    CCDS61743.1. [P67812-3]
    CCDS61744.1. [P67812-4]
    RefSeqiNP_001258847.1. NM_001271918.1.
    NP_001258848.1. NM_001271919.1.
    NP_001258849.1. NM_001271920.1.
    NP_001258850.1. NM_001271921.1.
    NP_001258851.1. NM_001271922.1.
    NP_055115.1. NM_014300.3.
    UniGeneiHs.9534.

    Genome annotation databases

    EnsembliENST00000268220; ENSP00000268220; ENSG00000140612. [P67812-1]
    ENST00000455959; ENSP00000413121; ENSG00000140612. [P67812-2]
    ENST00000558134; ENSP00000452697; ENSG00000140612. [P67812-3]
    ENST00000560266; ENSP00000452684; ENSG00000140612. [P67812-4]
    GeneIDi23478.
    KEGGihsa:23478.
    UCSCiuc002blb.2. human. [P67812-1]

    Polymorphism databases

    DMDMi54039634.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF108945 mRNA. Translation: AAD19640.1 .
    AF061737 mRNA. Translation: AAD17526.1 .
    AK300693 mRNA. Translation: BAG62376.1 .
    AK314146 mRNA. Translation: BAG36834.1 .
    AK223224 mRNA. Translation: BAD96944.1 .
    AC087732 Genomic DNA. No translation available.
    AC115102 Genomic DNA. No translation available.
    CH471101 Genomic DNA. Translation: EAX01952.1 .
    CH471101 Genomic DNA. Translation: EAX01954.1 .
    CH471101 Genomic DNA. Translation: EAX01956.1 .
    BC000359 mRNA. Translation: AAH00359.3 .
    BC014508 mRNA. Translation: AAH14508.1 .
    AF090315 mRNA. Translation: AAC36354.1 .
    CCDSi CCDS45340.1. [P67812-1 ]
    CCDS61742.1. [P67812-2 ]
    CCDS61743.1. [P67812-3 ]
    CCDS61744.1. [P67812-4 ]
    RefSeqi NP_001258847.1. NM_001271918.1.
    NP_001258848.1. NM_001271919.1.
    NP_001258849.1. NM_001271920.1.
    NP_001258850.1. NM_001271921.1.
    NP_001258851.1. NM_001271922.1.
    NP_055115.1. NM_014300.3.
    UniGenei Hs.9534.

    3D structure databases

    ProteinModelPortali P67812.
    SMRi P67812. Positions 49-146.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 117037. 7 interactions.
    IntActi P67812. 2 interactions.
    MINTi MINT-1387363.
    STRINGi 9606.ENSP00000268220.

    Protein family/group databases

    MEROPSi S26.009.

    PTM databases

    PhosphoSitei P67812.

    Polymorphism databases

    DMDMi 54039634.

    Proteomic databases

    MaxQBi P67812.
    PaxDbi P67812.
    PRIDEi P67812.

    Protocols and materials databases

    DNASUi 23478.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000268220 ; ENSP00000268220 ; ENSG00000140612 . [P67812-1 ]
    ENST00000455959 ; ENSP00000413121 ; ENSG00000140612 . [P67812-2 ]
    ENST00000558134 ; ENSP00000452697 ; ENSG00000140612 . [P67812-3 ]
    ENST00000560266 ; ENSP00000452684 ; ENSG00000140612 . [P67812-4 ]
    GeneIDi 23478.
    KEGGi hsa:23478.
    UCSCi uc002blb.2. human. [P67812-1 ]

    Organism-specific databases

    CTDi 23478.
    GeneCardsi GC15M085212.
    HGNCi HGNC:17718. SEC11A.
    neXtProti NX_P67812.
    PharmGKBi PA162402586.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0681.
    HOGENOMi HOG000111516.
    HOVERGENi HBG057279.
    InParanoidi P67812.
    KOi K13280.
    OMAi TKGDNNM.
    PhylomeDBi P67812.
    TreeFami TF313648.

    Enzyme and pathway databases

    Reactomei REACT_115902. SRP-dependent cotranslational protein targeting to membrane.
    REACT_19189. Synthesis, secretion, and deacylation of Ghrelin.
    REACT_23824. Synthesis, secretion, and inactivation of Glucose-dependent Insulinotropic Polypeptide (GIP).
    REACT_24019. Synthesis, secretion, and inactivation of Glucagon-like Peptide-1 (GLP-1).

    Miscellaneous databases

    ChiTaRSi SEC11A. human.
    GenomeRNAii 23478.
    NextBioi 35475221.
    PROi P67812.

    Gene expression databases

    ArrayExpressi P67812.
    Bgeei P67812.
    CleanExi HS_SEC11A.
    Genevestigatori P67812.

    Family and domain databases

    Gene3Di 2.10.109.10. 1 hit.
    InterProi IPR019758. Pept_S26A_signal_pept_1_CS.
    IPR019756. Pept_S26A_signal_pept_1_Ser-AS.
    IPR028360. Peptidase_S24/S26_b-rbn.
    IPR019759. Peptidase_S24_S26.
    IPR015927. Peptidase_S24_S26A/B/C.
    IPR001733. Peptidase_S26B.
    [Graphical view ]
    PANTHERi PTHR10806. PTHR10806. 1 hit.
    Pfami PF00717. Peptidase_S24. 1 hit.
    [Graphical view ]
    PRINTSi PR00728. SIGNALPTASE.
    SUPFAMi SSF51306. SSF51306. 1 hit.
    TIGRFAMsi TIGR02228. sigpep_I_arch. 1 hit.
    PROSITEi PS00501. SPASE_I_1. 1 hit.
    PS00761. SPASE_I_3. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Human signal peptidase 18 kDa subunit, mRNA complete cds."
      Xie T.P., Wu M.C., Liu X.P., Wang H.J., Liang Y., Guo Y.J.
      Submitted (NOV-1998) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Hepatoma.
    2. "Human microsomal signal peptidase."
      Zhang J., Mao M., Liu T., Wu J., Zhang Q., Fu G., Shen Y., Zhou J., Yu Y., Wang Z., Chen S., Chen Z.
      Submitted (APR-1998) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Neuroblastoma and Skeletal muscle.
    4. Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
      Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Gastric mucosa.
    5. "Analysis of the DNA sequence and duplication history of human chromosome 15."
      Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A.
      , Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.
      Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Colon and Muscle.
    8. Xie T.P., Liu X.P., Wang H.J., Liang Y., Wang H., Qian W.Z., Wei L.X., Liu Y.J., He P., Guo Y.J.
      Submitted (SEP-1998) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 13-179.
      Tissue: Hepatoma.
    9. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    10. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiSC11A_HUMAN
    AccessioniPrimary (citable) accession number: P67812
    Secondary accession number(s): B2RAD7
    , B4DUL4, H0YK72, H0YK83, O75957, P21378, Q53FQ8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 11, 2004
    Last sequence update: October 11, 2004
    Last modified: October 1, 2014
    This is version 96 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 15
      Human chromosome 15: entries, gene names and cross-references to MIM
    2. Peptidase families
      Classification of peptidase families and list of entries
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3