Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Calcineurin subunit B type 1

Gene

Ppp3r1

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. Confers calcium sensitivity.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Calcium bindingi31 – 42121Add
BLAST
Calcium bindingi63 – 74122Add
BLAST
Calcium bindingi100 – 111123Add
BLAST
Calcium bindingi141 – 152124Add
BLAST

GO - Molecular functioni

  • calcium ion binding Source: InterPro
  • phosphoprotein phosphatase activity Source: RGD

GO - Biological processi

  • protein dephosphorylation Source: RGD
Complete GO annotation...

Keywords - Ligandi

Calcium, Metal-binding

Enzyme and pathway databases

ReactomeiR-RNO-180024. DARPP-32 events.

Names & Taxonomyi

Protein namesi
Recommended name:
Calcineurin subunit B type 1
Alternative name(s):
Protein phosphatase 2B regulatory subunit 1
Protein phosphatase 3 regulatory subunit B alpha isoform 1
Gene namesi
Name:Ppp3r1
Synonyms:Cna2, Cnb
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Chromosome 14

Organism-specific databases

RGDi69230. Ppp3r1.

Subcellular locationi

  • Cytoplasmcytosol By similarity
  • Cell membrane By similarity; Lipid-anchor By similarity
  • Cell membranesarcolemma

  • Note: Translocates from the cytosol to the sarcolemma in a CIB1-dependent manner during cardiomyocytes hypertrophy.By similarity

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methionineiRemoved1 Publication
Chaini2 – 170169Calcineurin subunit B type 1PRO_0000073486Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Lipidationi2 – 21N-myristoyl glycine1 Publication
Modified residuei106 – 1061PhosphotyrosineBy similarity

Keywords - PTMi

Lipoprotein, Myristate, Phosphoprotein

Proteomic databases

PaxDbiP63100.
PRIDEiP63100.

PTM databases

iPTMnetiP63100.
PhosphoSiteiP63100.

Expressioni

Tissue specificityi

Isoform 2 is testis specific.1 Publication

Gene expression databases

BgeeiENSRNOG00000043210.
ExpressionAtlasiP63100. baseline and differential.
GenevisibleiP63100. RN.

Interactioni

Subunit structurei

Interacts with CIB1 (via C-terminal region); the interaction increases upon cardiomyocytes hypertrophy (By similarity). Composed of a catalytic subunit (A) and a regulatory subunit (B).By similarity

Protein-protein interaction databases

BioGridi248359. 2 interactions.
IntActiP63100. 3 interactions.
STRINGi10116.ENSRNOP00000037143.

Structurei

Secondary structure

1
170
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi17 – 3014Combined sources
Beta strandi35 – 384Combined sources
Helixi40 – 434Combined sources
Turni47 – 515Combined sources
Helixi55 – 628Combined sources
Beta strandi67 – 715Combined sources
Helixi72 – 809Combined sources
Helixi88 – 9912Combined sources
Beta strandi104 – 1074Combined sources
Helixi109 – 12012Combined sources
Helixi126 – 14015Combined sources
Beta strandi142 – 1487Combined sources
Helixi150 – 1578Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4IL1X-ray3.00A/B/C/D2-170[»]
ProteinModelPortaliP63100.
SMRiP63100. Positions 7-161.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini18 – 5134EF-hand 1PROSITE-ProRule annotationAdd
BLAST
Domaini50 – 8536EF-hand 2PROSITE-ProRule annotationAdd
BLAST
Domaini87 – 12236EF-hand 3PROSITE-ProRule annotationAdd
BLAST
Domaini128 – 16336EF-hand 4PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 4 EF-hand domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0034. Eukaryota.
COG5126. LUCA.
GeneTreeiENSGT00760000119179.
HOGENOMiHOG000233019.
HOVERGENiHBG105307.
InParanoidiP63100.
KOiK06268.
OrthoDBiEOG091G0R0W.
PhylomeDBiP63100.
TreeFamiTF105558.

Family and domain databases

Gene3Di1.10.238.10. 1 hit.
InterProiIPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
[Graphical view]
PfamiPF13499. EF-hand_7. 2 hits.
[Graphical view]
SMARTiSM00054. EFh. 4 hits.
[Graphical view]
SUPFAMiSSF47473. SSF47473. 1 hit.
PROSITEiPS00018. EF_HAND_1. 4 hits.
PS50222. EF_HAND_2. 4 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P63100-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGNEASYPLE MCSHFDADEI KRLGKRFKKL DLDNSGSLSV EEFMSLPELQ
60 70 80 90 100
QNPLVQRVID IFDTDGNGEV DFKEFIEGVS QFSVKGDKEQ KLRFAFRIYD
110 120 130 140 150
MDKDGYISNG ELFQVLKMMV GNNLKDTQLQ QIVDKTIINA DKDGDGRISF
160 170
EEFCAVVGGL DIHKKMVVDV
Length:170
Mass (Da):19,300
Last modified:January 23, 2007 - v2
Checksum:iC904715DC0386056
GO
Isoform 2 (identifier: P63100-2) [UniParc] [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-2: MG → MEQGTDLQSQIFFPTEKNFWKKGKDHFRQNKYPFSRELYNLIFADRKG

Show »
Length:216
Mass (Da):24,979
Checksum:i58B92B78438FDAD0
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 22MG → MEQGTDLQSQIFFPTEKNFW KKGKDHFRQNKYPFSRELYN LIFADRKG in isoform 2. 1 PublicationVSP_000729

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L03554 mRNA. Translation: AAA40854.1.
D14568 mRNA. Translation: BAA03422.1.
D14425 mRNA. Translation: BAA03318.1.
BC088855 mRNA. Translation: AAH88855.1.
PIRiS42716.
RefSeqiNP_059005.1. NM_017309.2. [P63100-1]
UniGeneiRn.42903.

Genome annotation databases

EnsembliENSRNOT00000067846; ENSRNOP00000058834; ENSRNOG00000043210. [P63100-1]
GeneIDi29748.
KEGGirno:29748.
UCSCiRGD:69230. rat.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L03554 mRNA. Translation: AAA40854.1.
D14568 mRNA. Translation: BAA03422.1.
D14425 mRNA. Translation: BAA03318.1.
BC088855 mRNA. Translation: AAH88855.1.
PIRiS42716.
RefSeqiNP_059005.1. NM_017309.2. [P63100-1]
UniGeneiRn.42903.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4IL1X-ray3.00A/B/C/D2-170[»]
ProteinModelPortaliP63100.
SMRiP63100. Positions 7-161.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi248359. 2 interactions.
IntActiP63100. 3 interactions.
STRINGi10116.ENSRNOP00000037143.

PTM databases

iPTMnetiP63100.
PhosphoSiteiP63100.

Proteomic databases

PaxDbiP63100.
PRIDEiP63100.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSRNOT00000067846; ENSRNOP00000058834; ENSRNOG00000043210. [P63100-1]
GeneIDi29748.
KEGGirno:29748.
UCSCiRGD:69230. rat.

Organism-specific databases

CTDi5534.
RGDi69230. Ppp3r1.

Phylogenomic databases

eggNOGiKOG0034. Eukaryota.
COG5126. LUCA.
GeneTreeiENSGT00760000119179.
HOGENOMiHOG000233019.
HOVERGENiHBG105307.
InParanoidiP63100.
KOiK06268.
OrthoDBiEOG091G0R0W.
PhylomeDBiP63100.
TreeFamiTF105558.

Enzyme and pathway databases

ReactomeiR-RNO-180024. DARPP-32 events.

Miscellaneous databases

PROiP63100.

Gene expression databases

BgeeiENSRNOG00000043210.
ExpressionAtlasiP63100. baseline and differential.
GenevisibleiP63100. RN.

Family and domain databases

Gene3Di1.10.238.10. 1 hit.
InterProiIPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
[Graphical view]
PfamiPF13499. EF-hand_7. 2 hits.
[Graphical view]
SMARTiSM00054. EFh. 4 hits.
[Graphical view]
SUPFAMiSSF47473. SSF47473. 1 hit.
PROSITEiPS00018. EF_HAND_1. 4 hits.
PS50222. EF_HAND_2. 4 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCANB1_RAT
AccessioniPrimary (citable) accession number: P63100
Secondary accession number(s): P06705, P15117, Q08044
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 1, 1988
Last sequence update: January 23, 2007
Last modified: September 7, 2016
This is version 109 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Miscellaneous

This protein has four functional calcium-binding sites.

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.