P63100 (CANB1_RAT) Reviewed, UniProtKB/Swiss-Prot
Last modified
November 16, 2011.
Version 68.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Calcineurin subunit B type 1 Alternative name(s): Protein phosphatase 2B regulatory subunit 1 Protein phosphatase 3 regulatory subunit B alpha isoform 1 | ||||
| Gene names |
| ||||
| Organism | Rattus norvegicus (Rat) | ||||
| Taxonomic identifier | 10116 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Rattus |
Protein attributes
| Sequence length | 170 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase, AND MASS SPECTROMETRY. Confers calcium sensitivity. |
| Subunit structure | Composed of a catalytic subunit (A) and a regulatory subunit (B). |
| Tissue specificity | |
| Miscellaneous | This protein has four functional calcium-binding sites. |
| Sequence similarities | Belongs to the calcineurin regulatory subunit family. Contains 4 EF-hand domains. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat |
| Ligand | Calcium |
| PTM | Lipoprotein Myristate Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | protein dephosphorylation Inferred from direct assay. Source: RGD |
| Molecular function | calcium ion binding Inferred from electronic annotation. Source: InterPro phosphoprotein phosphatase activityInferred from direct assay. Source: RGD protein bindingInferred from physical interaction. Source: RGD |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P63100-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P63100-2) The sequence of this isoform differs from the canonical sequence as follows: 1-2: MG → MEQGTDLQSQIFFPTEKNFWKKGKDHFRQNKYPFSRELYNLIFADRKG |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed | ||||||
| Chain | 2 – 170 | 169 | Calcineurin subunit B type 1 | PRO_0000073486 | |||||
Regions | |||||||||
| Domain | 18 – 51 | 34 | EF-hand 1 | ||||||
| Domain | 50 – 85 | 36 | EF-hand 2 | ||||||
| Domain | 87 – 122 | 36 | EF-hand 3 | ||||||
| Domain | 128 – 163 | 36 | EF-hand 4 | ||||||
| Calcium binding | 31 – 42 | 12 | 1 | ||||||
| Calcium binding | 63 – 74 | 12 | 2 | ||||||
| Calcium binding | 100 – 111 | 12 | 3 | ||||||
| Calcium binding | 141 – 152 | 12 | 4 | ||||||
Amino acid modifications | |||||||||
| Modified residue | 106 | 1 | Phosphotyrosine By similarity | ||||||
| Lipidation | 2 | 1 | N-myristoyl glycine Ref.4 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 2 | 2 | MG → MEQGTDLQSQIFFPTEKNFW KKGKDHFRQNKYPFSRELYN LIFADRKG in isoform 2. | VSP_000729 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Regulation of calcineurin phosphatase activity by the B subunit and carboxy-terminal inhibitory domains of the A subunit." Perrino B.A., Huang X., Ng L.Y., Soderling T.R. Submitted (OCT-1992) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Strain: Fischer. |
| [2] | "cDNA cloning of an alternatively spliced isoform of the regulatory subunit of Ca2+/calmodulin-dependent protein phosphatase (calcineurin B alpha 2)." Chang C.-D., Mukai H., Kuno T., Tanaka C. Biochim. Biophys. Acta 1217:174-180(1994) [PubMed: 8110831] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY. Tissue: Brain and Testis. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [4] | Lubec G., Chen W.-Q. Submitted (FEB-2007) to UniProtKB Cited for: MYRISTOYLATION AT GLY-2, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | L03554 mRNA. Translation: AAA40854.1. D14568 mRNA. Translation: BAA03422.1. D14425 mRNA. Translation: BAA03318.1. BC088855 mRNA. Translation: AAH88855.1. |
| IPI | IPI00206406. IPI00230947. |
| PIR | S42716. |
| RefSeq | NP_059005.1. NM_017309.2. |
| UniGene | Rn.42903. |
3D structure databases | |
| ProteinModelPortal | P63100. |
| SMR | P63100. Positions 16-170. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P63100. 1 interaction. |
| STRING | P63100. |
Proteomic databases | |
| PRIDE | P63100. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSRNOT00000031275; ENSRNOP00000037143; ENSRNOG00000043210. ENSRNOT00000067846; ENSRNOP00000058834; ENSRNOG00000043210. |
| GeneID | 29748. |
| KEGG | rno:29748. |
| UCSC | D14425. rat. |
Organism-specific databases | |
| CTD | 5534. |
| RGD | 69230. Ppp3r1. |
Phylogenomic databases | |
| eggNOG | roNOG10668. |
| GeneTree | ENSGT00600000084053. |
| HOVERGEN | HBG105307. |
| OMA | IYDIDKD. |
| PhylomeDB | P63100. |
Gene expression databases | |
| ArrayExpress | P63100. |
| Genevestigator | P63100. |
| GermOnline | ENSRNOG00000022857. Rattus norvegicus. |
Family and domain databases | |
| InterPro | IPR018248. EF-hand. IPR011992. EF-hand-like_dom. IPR018247. EF_Hand_1_Ca_BS. IPR018249. EF_HAND_2. IPR002048. EF_hand_Ca-bd. IPR008080. Parvalbumin. [Graphical view] |
| Gene3D | G3DSA:1.10.238.10. EF-Hand_type. 3 hits. |
| KO | K06268. |
| Pfam | PF00036. efhand. 3 hits. [Graphical view] |
| PRINTS | PR01697. PARVALBUMIN. |
| SMART | SM00054. EFh. 4 hits. [Graphical view] |
| PROSITE | PS00018. EF_HAND_1. 4 hits. PS50222. EF_HAND_2. 4 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 610269. |
Entry information
| Entry name | CANB1_RAT | ||||||||
| Accession | Primary (citable) accession number: P63100 Secondary accession number(s): P06705, P15117, Q08044 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| SIMILARITY comments Index of protein domains and families |

Clusters with