Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Noelin-3

Gene

Olfm3

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

GO - Biological processi

  • eye photoreceptor cell development Source: RGD
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Noelin-3
Alternative name(s):
Olfactomedin-3
Optimedin
Gene namesi
Name:Olfm3
Synonyms:Noe3
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Chromosome 2

Organism-specific databases

RGDi628672. Olfm3.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Secreted, Synapse

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2323Sequence analysisAdd
BLAST
Chaini24 – 478455Noelin-3PRO_0000020082Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi33 – 331N-linked (GlcNAc...)Sequence analysis
Glycosylationi95 – 951N-linked (GlcNAc...)Sequence analysis
Glycosylationi179 – 1791N-linked (GlcNAc...)Sequence analysis
Disulfide bondi219 ↔ 401PROSITE-ProRule annotation
Glycosylationi299 – 2991N-linked (GlcNAc...)Sequence analysis
Glycosylationi465 – 4651N-linked (GlcNAc...)Sequence analysis

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiP63057.
PRIDEiP63057.

Expressioni

Tissue specificityi

Expressed in the brain (at protein level). Also expressed in the retina, mainly in the ganglion cell layer and in the amacrine cell subregion of the inner nuclear layer. Expressed at high levels in the epithelial cells of the posterior iris and the ciliary body and, at lower levels, in the trabecular meshwork. Isoform 2 preferentially expressed in retina and brain, while isoform 1 preferentially expressed in the tissues of the eye angle.2 Publications

Gene expression databases

GenevisibleiP63057. RN.

Interactioni

Subunit structurei

Peripherally associated with AMPAR complex. AMPAR complex consists of an inner core made of 4 pore-forming GluA/GRIA proteins (GRIA1, GRIA2, GRIA3 and GRIA4) and 4 major auxiliary subunits arranged in a twofold symmetry. One of the two pairs of distinct binding sites is occupied either by CNIH2, CNIH3 or CACNG2, CACNG3. The other harbors CACNG2, CACNG3, CACNG4, CACNG8 or GSG1L. This inner core of AMPAR complex is complemented by outer core constituents binding directly to the GluA/GRIA proteins at sites distinct from the interaction sites of the inner core constituents. Outer core constituents include at least PRRT1, PRRT2, CKAMP44/SHISA9, FRRS1L and NRN1. The proteins of the inner and outer core serve as a platform for other, more peripherally associated AMPAR constituents, including OLFM3. Alone or in combination, these auxiliary subunits control the gating and pharmacology of the AMPAR complex and profoundly impact their biogenesis and protein processing (PubMed:22632720). Homodimer. Interacts with MYOC (PubMed:12019210). Interacts with OLFM2 (By similarity).By similarity2 Publications

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000024243.

Structurei

3D structure databases

ProteinModelPortaliP63057.
SMRiP63057. Positions 217-472.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini218 – 470253Olfactomedin-likePROSITE-ProRule annotationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili77 – 217141Sequence analysisAdd
BLAST

Sequence similaritiesi

Contains 1 olfactomedin-like domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Signal

Phylogenomic databases

eggNOGiENOG410KCV8. Eukaryota.
ENOG410ZVS0. LUCA.
GeneTreeiENSGT00760000119005.
HOGENOMiHOG000232069.
HOVERGENiHBG006513.
InParanoidiP63057.
OMAiIKYSFDT.
OrthoDBiEOG75F4CZ.
PhylomeDBiP63057.
TreeFamiTF315964.

Family and domain databases

InterProiIPR031216. Noelin-3.
IPR022082. Noelin_dom.
IPR003112. Olfac-like_dom.
IPR011044. Quino_amine_DH_bsu.
[Graphical view]
PANTHERiPTHR23192:SF36. PTHR23192:SF36. 1 hit.
PfamiPF12308. Noelin-1. 1 hit.
PF02191. OLF. 1 hit.
[Graphical view]
SMARTiSM00284. OLF. 1 hit.
[Graphical view]
SUPFAMiSSF50969. SSF50969. 3 hits.
PROSITEiPS51132. OLF. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P63057-1) [UniParc]FASTAAdd to basket

Also known as: B

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSAPLLKLGA VLSTMAMISN WMSQTLPSLV GLNTTRLSAP DTLTQISPKE
60 70 80 90 100
GWQVYSSAQD PDGRCICTVV APEQNLCSRD AKSRQLRQLL EKVQNMSQSI
110 120 130 140 150
EVLNLRTQRD FQYVLKMETQ MKGLKAKFRQ IEDDRKTLMT KHFQELKEKM
160 170 180 190 200
DELLPLIPVL EQYKTDAKLI TQFKEEIRNL SSVLTGIQEE IGAYDYEELH
210 220 230 240 250
QRVLSLETRL RDCMKKLTCG KLMKITGPIT VKTSGTRFGA WMTDPLASEK
260 270 280 290 300
NNRVWYMDSY TNNKIVREYK SIADFVSGAE SRTYNLPFKW AGTNHVVYNG
310 320 330 340 350
SLYFNKYQSN IIIKYSFDLG RVLAQRSLEY AGFHNVYPYT WGGFSDIDLM
360 370 380 390 400
ADEIGLWAVY ATNQNAGNIV ISQLNQDTLE VMKSWSTGYP KRSAGESFMI
410 420 430 440 450
CGTLYVTNSH LTGAKVYYSY STKTSTYEYT DIPFHNQYFH ISMLDYNARD
460 470
RALYAWNNGH QVLFNVTLFH IIKTEDDT
Length:478
Mass (Da):54,886
Last modified:September 13, 2004 - v1
Checksum:iED4250E58213787D
GO
Isoform 2 (identifier: P63057-2) [UniParc] [UniParc]FASTAAdd to basket

Also known as: A

The sequence of this isoform differs from the canonical sequence as follows:
     1-43: MSAPLLKLGAVLSTMAMISNWMSQTLPSLVGLNTTRLSAPDTL → MQARSSFLNLLLLSLLAGLDPSK

Show »
Length:458
Mass (Da):52,841
Checksum:i80371F2B171E58EF
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4343MSAPL…APDTL → MQARSSFLNLLLLSLLAGLD PSK in isoform 2. 1 PublicationVSP_011549Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF442822 mRNA. Translation: AAL87041.1.
AF442823 mRNA. Translation: AAL87042.1.
RefSeqiNP_665720.1. NM_145777.1. [P63057-1]
UniGeneiRn.27711.

Genome annotation databases

EnsembliENSRNOT00000024243; ENSRNOP00000024243; ENSRNOG00000017969. [P63057-1]
GeneIDi252920.
KEGGirno:252920.
UCSCiRGD:628672. rat.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF442822 mRNA. Translation: AAL87041.1.
AF442823 mRNA. Translation: AAL87042.1.
RefSeqiNP_665720.1. NM_145777.1. [P63057-1]
UniGeneiRn.27711.

3D structure databases

ProteinModelPortaliP63057.
SMRiP63057. Positions 217-472.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000024243.

Proteomic databases

PaxDbiP63057.
PRIDEiP63057.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSRNOT00000024243; ENSRNOP00000024243; ENSRNOG00000017969. [P63057-1]
GeneIDi252920.
KEGGirno:252920.
UCSCiRGD:628672. rat.

Organism-specific databases

CTDi118427.
RGDi628672. Olfm3.

Phylogenomic databases

eggNOGiENOG410KCV8. Eukaryota.
ENOG410ZVS0. LUCA.
GeneTreeiENSGT00760000119005.
HOGENOMiHOG000232069.
HOVERGENiHBG006513.
InParanoidiP63057.
OMAiIKYSFDT.
OrthoDBiEOG75F4CZ.
PhylomeDBiP63057.
TreeFamiTF315964.

Miscellaneous databases

NextBioi624065.
PROiP63057.

Gene expression databases

GenevisibleiP63057. RN.

Family and domain databases

InterProiIPR031216. Noelin-3.
IPR022082. Noelin_dom.
IPR003112. Olfac-like_dom.
IPR011044. Quino_amine_DH_bsu.
[Graphical view]
PANTHERiPTHR23192:SF36. PTHR23192:SF36. 1 hit.
PfamiPF12308. Noelin-1. 1 hit.
PF02191. OLF. 1 hit.
[Graphical view]
SMARTiSM00284. OLF. 1 hit.
[Graphical view]
SUPFAMiSSF50969. SSF50969. 3 hits.
PROSITEiPS51132. OLF. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Optimedin: a novel olfactomedin-related protein that interacts with myocilin."
    Torrado M., Trivedi R., Zinovieva R., Karavanova I., Tomarev S.I.
    Hum. Mol. Genet. 11:1291-1301(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY, INTERACTION WITH MYOC.
    Strain: Wistar.
    Tissue: Eye.
  2. "High-resolution proteomics unravel architecture and molecular diversity of native AMPA receptor complexes."
    Schwenk J., Harmel N., Brechet A., Zolles G., Berkefeld H., Muller C.S., Bildl W., Baehrens D., Huber B., Kulik A., Klocker N., Schulte U., Fakler B.
    Neuron 74:621-633(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION IN AMPAR COMPLEX, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.

Entry informationi

Entry nameiNOE3_RAT
AccessioniPrimary (citable) accession number: P63057
Secondary accession number(s): Q8BKV2
, Q8BLL6, Q8QZW0, Q8R4K3, Q8R4K4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 13, 2004
Last sequence update: September 13, 2004
Last modified: November 11, 2015
This is version 78 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.