P63057 (NOE3_RAT) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 60.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Noelin-3 Alternative name(s): Olfactomedin-3 Optimedin | ||||
| Gene names |
| ||||
| Organism | Rattus norvegicus (Rat) [Reference proteome] | ||||
| Taxonomic identifier | 10116 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Rattus![]() |
Protein attributes
| Sequence length | 478 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Subunit structure | Peripherally associated with AMPAR complex. AMPAR complex consists of an inner core made of 4 pore-forming GluA/GRIA proteins (GRIA1, GRIA2, GRIA3 and GRIA4) and 4 major auxiliary subunits arranged in a twofold symmetry. One of the two pairs of distinct binding sites is occupied either by CNIH2, CNIH3 or CACNG2, CACNG3. The other harbors CACNG2, CACNG3, CACNG4, CACNG8 or GSG1L. This inner core of AMPAR complex is complemented by outer core constituents binding directly to the GluA/GRIA proteins at sites distinct from the interaction sites of the inner core constituents. Outer core constituents include at least PRRT1, PRRT2, CKAMP44/SHISA9, FRRS1L and NRN1. The proteins of the inner and outer core serve as a platform for other, more peripherally associated AMPAR constituents, including OLFM3. Alone or in combination, these auxiliary subunits control the gating and pharmacology of the AMPAR complex and profoundly impact their biogenesis and protein processing. Homodimer. Interacts with MYOC. Ref.1 Ref.2 |
| Subcellular location | Secreted. Cell junction › synapse Probable. Note: Isoform 2 is secreted more efficiently than isoform 1. Ref.2 |
| Tissue specificity | Expressed in the brain (at protein level). Also expressed in the retina, mainly in the ganglion cell layer and in the amacrine cell subregion of the inner nuclear layer. Expressed at high levels in the epithelial cells of the posterior iris and the ciliary body and, at lower levels, in the trabecular meshwork. Isoform 2 preferentially expressed in retina and brain, while isoform 1 preferentially expressed in the tissues of the eye angle. Ref.1 Ref.2 |
| Sequence similarities | Contains 1 olfactomedin-like domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell junction Secreted Synapse |
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil Signal |
| PTM | Disulfide bond Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | eye photoreceptor cell development Inferred from direct assay Ref.1. Source: RGD |
| Cellular_component | Golgi apparatus Inferred from electronic annotation. Source: Compara cell junctionInferred from electronic annotation. Source: UniProtKB-KW extracellular spaceInferred from electronic annotation. Source: Compara synapseInferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P63057-1) Also known as: B; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P63057-2) Also known as: A; The sequence of this isoform differs from the canonical sequence as follows: 1-43: MSAPLLKLGAVLSTMAMISNWMSQTLPSLVGLNTTRLSAPDTL → MQARSSFLNLLLLSLLAGLDPSK |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 23 | 23 | Potential | ||||||||
| Chain | 24 – 478 | 455 | Noelin-3 | PRO_0000020082 | |||||||
Regions | |||||||||||
| Domain | 218 – 470 | 253 | Olfactomedin-like | ||||||||
| Coiled coil | 77 – 217 | 141 | Potential | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 33 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 95 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 179 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 299 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 465 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 219 ↔ 401 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 43 | 43 | MSAPL…APDTL → MQARSSFLNLLLLSLLAGLD PSK in isoform 2. | VSP_011549 | |||||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "Optimedin: a novel olfactomedin-related protein that interacts with myocilin." Torrado M., Trivedi R., Zinovieva R., Karavanova I., Tomarev S.I. Hum. Mol. Genet. 11:1291-1301(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY, INTERACTION WITH MYOC. Strain: Wistar. Tissue: Eye. |
| [2] | "High-resolution proteomics unravel architecture and molecular diversity of native AMPA receptor complexes." Schwenk J., Harmel N., Brechet A., Zolles G., Berkefeld H., Muller C.S., Bildl W., Baehrens D., Huber B., Kulik A., Klocker N., Schulte U., Fakler B. Neuron 74:621-633(2012) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION IN AMPAR COMPLEX, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF442822 mRNA. Translation: AAL87041.1. AF442823 mRNA. Translation: AAL87042.1. |
| IPI | IPI00206275. IPI00337161. |
| RefSeq | NP_665720.1. NM_145777.1. |
| UniGene | Rn.27711. |
3D structure databases | |
| ProteinModelPortal | P63057. |
| ModBase | Search... |
Proteomic databases | |
| PaxDb | P63057. |
| PRIDE | P63057. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSRNOT00000024243; ENSRNOP00000024243; ENSRNOG00000017969. |
| GeneID | 252920. |
| KEGG | rno:252920. |
| UCSC | RGD:628672. rat. |
Organism-specific databases | |
| CTD | 118427. |
| RGD | 628672. Olfm3. |
Phylogenomic databases | |
| eggNOG | NOG323050. |
| GeneTree | ENSGT00660000095208. |
| HOGENOM | HOG000232069. |
| HOVERGEN | HBG006513. |
| InParanoid | P63057. |
| OMA | MKSWNTG. |
| OrthoDB | EOG4R23TR. |
Gene expression databases | |
| ArrayExpress | P63057. |
| Genevestigator | P63057. |
| GermOnline | ENSRNOG00000017969. Rattus norvegicus. |
Family and domain databases | |
| InterPro | IPR022082. Noelin-1. IPR003112. Olfac-like. [Graphical view] |
| Pfam | PF12308. Noelin-1. 1 hit. PF02191. OLF. 1 hit. [Graphical view] |
| SMART | SM00284. OLF. 1 hit. [Graphical view] |
| PROSITE | PS51132. OLF. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 624065. |
Entry information
| Entry name | NOE3_RAT | ||||||||
| Accession | Primary (citable) accession number: P63057 Secondary accession number(s): Q8BKV2 Q8R4K4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| SIMILARITY comments Index of protein domains and families |

Clusters with
