Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Paired mesoderm homeobox protein 1

Gene

Prrx1

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Acts as a transcriptional regulator of muscle creatine kinase (MCK) and so has a role in the establishment of diverse mesodermal muscle types. The protein binds to an A/T-rich element in the muscle creatine enhancer (By similarity).By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi94 – 153HomeoboxPROSITE-ProRule annotationAdd BLAST60

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Ligandi

DNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Paired mesoderm homeobox protein 1
Alternative name(s):
Paired-related homeobox protein 1
Short name:
PRX-1
Short name:
rHox
Gene namesi
Name:Prrx1
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Chromosome 13

Organism-specific databases

RGDi628884. Prrx1.

Subcellular locationi

  • Nucleus PROSITE-ProRule annotation

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000492531 – 245Paired mesoderm homeobox protein 1Add BLAST245

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei21PhosphoserineCombined sources1
Modified residuei160N6-acetyllysineBy similarity1
Modified residuei197PhosphoserineSequence analysis1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

PaxDbiP63014.

PTM databases

iPTMnetiP63014.
PhosphoSitePlusiP63014.

Expressioni

Gene expression databases

BgeeiENSRNOG00000003720.
GenevisibleiP63014. RN.

Interactioni

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000004950.

Structurei

3D structure databases

ProteinModelPortaliP63014.
SMRiP63014.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi222 – 235OARPROSITE-ProRule annotationAdd BLAST14

Sequence similaritiesi

Belongs to the paired homeobox family.Curated
Contains 1 homeobox DNA-binding domain.PROSITE-ProRule annotation

Keywords - Domaini

Homeobox

Phylogenomic databases

eggNOGiKOG0490. Eukaryota.
ENOG410YIJ3. LUCA.
GeneTreeiENSGT00760000118958.
HOGENOMiHOG000231518.
HOVERGENiHBG021349.
InParanoidiP63014.
KOiK09329.
OMAiMATYPPT.
OrthoDBiEOG091G0B1L.
PhylomeDBiP63014.
TreeFamiTF351612.

Family and domain databases

Gene3Di1.10.10.60. 1 hit.
InterProiIPR017970. Homeobox_CS.
IPR001356. Homeobox_dom.
IPR009057. Homeodomain-like.
IPR003654. OAR_dom.
[Graphical view]
PfamiPF00046. Homeobox. 1 hit.
PF03826. OAR. 1 hit.
[Graphical view]
SMARTiSM00389. HOX. 1 hit.
[Graphical view]
SUPFAMiSSF46689. SSF46689. 1 hit.
PROSITEiPS00027. HOMEOBOX_1. 1 hit.
PS50071. HOMEOBOX_2. 1 hit.
PS50803. OAR. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P63014-1) [UniParc]FASTAAdd to basket
Also known as: Prx1a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTSSYGHVLE RQPALGGRLD SPGNLDTLQA KKNFSVSHLL DLEEAGDMVA
60 70 80 90 100
AQADESVGEA GRSLLESPGL TSGSDTPQQD NDQLNSEEKK KRKQRRNRTT
110 120 130 140 150
FNSSQLQALE RVFERTHYPD AFVREDLARR VNLTEARVQV WFQNRRAKFR
160 170 180 190 200
RNERAMLANK NASLLKSYSG DVTAVEQPIV PRPAPRPTDY LSWGTASPYS
210 220 230 240
AMATYSATCA NNSPAQGINM ANSIANLRLK AKEYSLQRNQ VPTVN
Length:245
Mass (Da):27,269
Last modified:August 31, 2004 - v1
Checksum:iFF867F0D856E1115
GO
Isoform 2 (identifier: P63014-2) [UniParc]FASTAAdd to basket
Also known as: Prx1b

The sequence of this isoform differs from the canonical sequence as follows:
     200-245: SAMATYSATCANNSPAQGINMANSIANLRLKAKEYSLQRNQVPTVN → RSSSLPRCCLHEGLHNGF

Show »
Length:217
Mass (Da):24,369
Checksum:iA4C1F7A6DF8CE652
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_053544200 – 245SAMAT…VPTVN → RSSSLPRCCLHEGLHNGF in isoform 2. 1 PublicationAdd BLAST46

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
S82911 mRNA. Translation: AAB46839.1.
AY730764 mRNA. Translation: AAU21314.1.
CH473958 Genomic DNA. Translation: EDM09378.1.
RefSeqiNP_722543.1. NM_153821.1. [P63014-1]
XP_006250213.1. XM_006250151.3. [P63014-2]
UniGeneiRn.203584.

Genome annotation databases

EnsembliENSRNOT00000004950; ENSRNOP00000004950; ENSRNOG00000003720. [P63014-1]
ENSRNOT00000082385; ENSRNOP00000075169; ENSRNOG00000003720. [P63014-2]
GeneIDi266813.
KEGGirno:266813.
UCSCiRGD:628884. rat. [P63014-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
S82911 mRNA. Translation: AAB46839.1.
AY730764 mRNA. Translation: AAU21314.1.
CH473958 Genomic DNA. Translation: EDM09378.1.
RefSeqiNP_722543.1. NM_153821.1. [P63014-1]
XP_006250213.1. XM_006250151.3. [P63014-2]
UniGeneiRn.203584.

3D structure databases

ProteinModelPortaliP63014.
SMRiP63014.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000004950.

PTM databases

iPTMnetiP63014.
PhosphoSitePlusiP63014.

Proteomic databases

PaxDbiP63014.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSRNOT00000004950; ENSRNOP00000004950; ENSRNOG00000003720. [P63014-1]
ENSRNOT00000082385; ENSRNOP00000075169; ENSRNOG00000003720. [P63014-2]
GeneIDi266813.
KEGGirno:266813.
UCSCiRGD:628884. rat. [P63014-1]

Organism-specific databases

CTDi5396.
RGDi628884. Prrx1.

Phylogenomic databases

eggNOGiKOG0490. Eukaryota.
ENOG410YIJ3. LUCA.
GeneTreeiENSGT00760000118958.
HOGENOMiHOG000231518.
HOVERGENiHBG021349.
InParanoidiP63014.
KOiK09329.
OMAiMATYPPT.
OrthoDBiEOG091G0B1L.
PhylomeDBiP63014.
TreeFamiTF351612.

Miscellaneous databases

PROiP63014.

Gene expression databases

BgeeiENSRNOG00000003720.
GenevisibleiP63014. RN.

Family and domain databases

Gene3Di1.10.10.60. 1 hit.
InterProiIPR017970. Homeobox_CS.
IPR001356. Homeobox_dom.
IPR009057. Homeodomain-like.
IPR003654. OAR_dom.
[Graphical view]
PfamiPF00046. Homeobox. 1 hit.
PF03826. OAR. 1 hit.
[Graphical view]
SMARTiSM00389. HOX. 1 hit.
[Graphical view]
SUPFAMiSSF46689. SSF46689. 1 hit.
PROSITEiPS00027. HOMEOBOX_1. 1 hit.
PS50071. HOMEOBOX_2. 1 hit.
PS50803. OAR. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPRRX1_RAT
AccessioniPrimary (citable) accession number: P63014
Secondary accession number(s): P43271, Q02810, Q643W9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 31, 2004
Last sequence update: August 31, 2004
Last modified: November 2, 2016
This is version 101 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.