Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P63013

- PRRX1_MOUSE

UniProt

P63013 - PRRX1_MOUSE

Protein

Paired mesoderm homeobox protein 1

Gene

Prrx1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 94 (01 Oct 2014)
      Sequence version 1 (31 Aug 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Acts as a transcriptional regulator of muscle creatine kinase (MCK) and so has a role in the establishment of diverse mesodermal muscle types. The protein binds to an A/T-rich element in the muscle creatine enhancer.

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    DNA bindingi94 – 15360HomeoboxPROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. DNA binding Source: MGI
    2. HMG box domain binding Source: UniProtKB
    3. sequence-specific DNA binding Source: InterPro
    4. sequence-specific DNA binding transcription factor activity Source: InterPro

    GO - Biological processi

    1. artery morphogenesis Source: MGI
    2. cartilage development Source: MGI
    3. embryonic cranial skeleton morphogenesis Source: MGI
    4. embryonic limb morphogenesis Source: MGI
    5. embryonic skeletal system morphogenesis Source: MGI
    6. inner ear morphogenesis Source: MGI
    7. middle ear morphogenesis Source: MGI
    8. negative regulation of transcription from RNA polymerase II promoter Source: Ensembl
    9. palate development Source: MGI
    10. positive regulation of mesenchymal cell proliferation Source: MGI
    11. positive regulation of smoothened signaling pathway Source: MGI

    Keywords - Molecular functioni

    Developmental protein

    Keywords - Ligandi

    DNA-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Paired mesoderm homeobox protein 1
    Alternative name(s):
    Homeobox protein K-2
    Homeobox protein mHox
    Paired-related homeobox protein 1
    Short name:
    PRX-1
    Gene namesi
    Name:Prrx1
    Synonyms:Pmx, Pmx1
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 1

    Organism-specific databases

    MGIiMGI:97712. Prrx1.

    Subcellular locationi

    GO - Cellular componenti

    1. nucleolus Source: Ensembl
    2. nucleus Source: MGI

    Keywords - Cellular componenti

    Nucleus

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 245245Paired mesoderm homeobox protein 1PRO_0000049252Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei160 – 1601N6-acetyllysine1 Publication
    Modified residuei197 – 1971PhosphoserineSequence Analysis

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    PRIDEiP63013.

    PTM databases

    PhosphoSiteiP63013.

    Expressioni

    Tissue specificityi

    Expressed exclusively in mesodermally derived cell types. During embryogenesis, highest levels of expression are found in the mesenchyme and precartilage elements of the face and hind limbs. In the adult, expression is restricted to skeletal muscle, heart and uterus.

    Developmental stagei

    Expressed during cardiogenesis.

    Gene expression databases

    ArrayExpressiP63013.
    BgeeiP63013.
    CleanExiMM_PRRX1.
    GenevestigatoriP63013.

    Interactioni

    Protein-protein interaction databases

    BioGridi202269. 2 interactions.
    IntActiP63013. 1 interaction.
    STRINGi10090.ENSMUSP00000027878.

    Structurei

    3D structure databases

    ProteinModelPortaliP63013.
    SMRiP63013. Positions 94-150.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi222 – 23514OARAdd
    BLAST

    Sequence similaritiesi

    Belongs to the paired homeobox family.Curated
    Contains 1 homeobox DNA-binding domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Homeobox

    Phylogenomic databases

    eggNOGiNOG267226.
    GeneTreeiENSGT00750000117349.
    HOGENOMiHOG000231518.
    HOVERGENiHBG021349.
    InParanoidiP63013.
    KOiK09329.
    OMAiWGSAAPY.
    OrthoDBiEOG7DFXD8.
    PhylomeDBiP63013.
    TreeFamiTF351612.

    Family and domain databases

    Gene3Di1.10.10.60. 1 hit.
    InterProiIPR017970. Homeobox_CS.
    IPR001356. Homeobox_dom.
    IPR009057. Homeodomain-like.
    IPR003654. OAR_dom.
    [Graphical view]
    PfamiPF00046. Homeobox. 1 hit.
    PF03826. OAR. 1 hit.
    [Graphical view]
    SMARTiSM00389. HOX. 1 hit.
    [Graphical view]
    SUPFAMiSSF46689. SSF46689. 1 hit.
    PROSITEiPS00027. HOMEOBOX_1. 1 hit.
    PS50071. HOMEOBOX_2. 1 hit.
    PS50803. OAR. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P63013-1) [UniParc]FASTAAdd to Basket

    Also known as: K2-a, PMX1-B, Prx1a

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MTSSYGHVLE RQPALGGRLD SPGNLDTLQA KKNFSVSHLL DLEEAGDMVA    50
    AQADESVGEA GRSLLESPGL TSGSDTPQQD NDQLNSEEKK KRKQRRNRTT 100
    FNSSQLQALE RVFERTHYPD AFVREDLARR VNLTEARVQV WFQNRRAKFR 150
    RNERAMLANK NASLLKSYSG DVTAVEQPIV PRPAPRPTDY LSWGTASPYS 200
    AMATYSATCA NNSPAQGINM ANSIANLRLK AKEYSLQRNQ VPTVN 245
    Length:245
    Mass (Da):27,269
    Last modified:August 31, 2004 - v1
    Checksum:iFF867F0D856E1115
    GO
    Isoform 2 (identifier: P63013-2) [UniParc] [UniParc]FASTAAdd to Basket

    Also known as: K2-b, PMX1-A, Prx1b

    The sequence of this isoform differs from the canonical sequence as follows:
         200-245: SAMATYSATCANNSPAQGINMANSIANLRLKAKEYSLQRNQVPTVN → RSSSLPRCCLHEGLHNGF

    Show »
    Length:217
    Mass (Da):24,369
    Checksum:iA4C1F7A6DF8CE652
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei200 – 24546SAMAT…VPTVN → RSSSLPRCCLHEGLHNGF in isoform 2. 3 PublicationsVSP_002279Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L06502 mRNA. Translation: AAA39672.1.
    U03873 mRNA. Translation: AAC52139.1.
    X59725 mRNA. Translation: CAA42410.1.
    BC092372 mRNA. Translation: AAH92372.1.
    CCDSiCCDS15427.1.
    CCDS15428.1. [P63013-2]
    PIRiI48902.
    S26076.
    RefSeqiNP_035257.1. NM_011127.2. [P63013-1]
    NP_783617.2. NM_175686.3. [P63013-2]
    XP_006496766.1. XM_006496703.1. [P63013-2]
    UniGeneiMm.288642.

    Genome annotation databases

    EnsembliENSMUST00000027878; ENSMUSP00000027878; ENSMUSG00000026586. [P63013-1]
    ENSMUST00000075805; ENSMUSP00000075203; ENSMUSG00000026586. [P63013-2]
    GeneIDi18933.
    KEGGimmu:18933.
    UCSCiuc007dhh.1. mouse. [P63013-2]
    uc007dhi.1. mouse.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L06502 mRNA. Translation: AAA39672.1 .
    U03873 mRNA. Translation: AAC52139.1 .
    X59725 mRNA. Translation: CAA42410.1 .
    BC092372 mRNA. Translation: AAH92372.1 .
    CCDSi CCDS15427.1.
    CCDS15428.1. [P63013-2 ]
    PIRi I48902.
    S26076.
    RefSeqi NP_035257.1. NM_011127.2. [P63013-1 ]
    NP_783617.2. NM_175686.3. [P63013-2 ]
    XP_006496766.1. XM_006496703.1. [P63013-2 ]
    UniGenei Mm.288642.

    3D structure databases

    ProteinModelPortali P63013.
    SMRi P63013. Positions 94-150.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 202269. 2 interactions.
    IntActi P63013. 1 interaction.
    STRINGi 10090.ENSMUSP00000027878.

    PTM databases

    PhosphoSitei P63013.

    Proteomic databases

    PRIDEi P63013.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000027878 ; ENSMUSP00000027878 ; ENSMUSG00000026586 . [P63013-1 ]
    ENSMUST00000075805 ; ENSMUSP00000075203 ; ENSMUSG00000026586 . [P63013-2 ]
    GeneIDi 18933.
    KEGGi mmu:18933.
    UCSCi uc007dhh.1. mouse. [P63013-2 ]
    uc007dhi.1. mouse.

    Organism-specific databases

    CTDi 5396.
    MGIi MGI:97712. Prrx1.

    Phylogenomic databases

    eggNOGi NOG267226.
    GeneTreei ENSGT00750000117349.
    HOGENOMi HOG000231518.
    HOVERGENi HBG021349.
    InParanoidi P63013.
    KOi K09329.
    OMAi WGSAAPY.
    OrthoDBi EOG7DFXD8.
    PhylomeDBi P63013.
    TreeFami TF351612.

    Miscellaneous databases

    ChiTaRSi PRRX1. mouse.
    NextBioi 295248.
    PROi P63013.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P63013.
    Bgeei P63013.
    CleanExi MM_PRRX1.
    Genevestigatori P63013.

    Family and domain databases

    Gene3Di 1.10.10.60. 1 hit.
    InterProi IPR017970. Homeobox_CS.
    IPR001356. Homeobox_dom.
    IPR009057. Homeodomain-like.
    IPR003654. OAR_dom.
    [Graphical view ]
    Pfami PF00046. Homeobox. 1 hit.
    PF03826. OAR. 1 hit.
    [Graphical view ]
    SMARTi SM00389. HOX. 1 hit.
    [Graphical view ]
    SUPFAMi SSF46689. SSF46689. 1 hit.
    PROSITEi PS00027. HOMEOBOX_1. 1 hit.
    PS50071. HOMEOBOX_2. 1 hit.
    PS50803. OAR. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "MHox: a mesodermally restricted homeodomain protein that binds an essential site in the muscle creatine kinase enhancer."
      Cserjesi P., Lilly B., Bryson L., Wang Y., Sassoon D.A., Olson E.N.
      Development 115:1087-1101(1992) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    2. "Genomic organization and chromosome localization of the murine homeobox gene Pmx."
      Kern M.J., Argao E.A., Birkenmeier E.H., Rowe L.B., Potter S.S.
      Genomics 19:334-340(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    3. "A novel murine homeobox gene isolated by a tissue specific PCR cloning strategy."
      Kern M.J., Witte D.P., Valerius M.T., Aronow B.J., Potter S.S.
      Nucleic Acids Res. 20:5189-5195(1992) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Strain: CD-1.
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Strain: C57BL/6.
      Tissue: Brain.
    5. "SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways."
      Park J., Chen Y., Tishkoff D.X., Peng C., Tan M., Dai L., Xie Z., Zhang Y., Zwaans B.M., Skinner M.E., Lombard D.B., Zhao Y.
      Mol. Cell 50:919-930(2013) [PubMed] [Europe PMC] [Abstract]
      Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-160, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Embryonic fibroblast.

    Entry informationi

    Entry nameiPRRX1_MOUSE
    AccessioniPrimary (citable) accession number: P63013
    Secondary accession number(s): P43271, Q02810, Q569N6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: August 31, 2004
    Last sequence update: August 31, 2004
    Last modified: October 1, 2014
    This is version 94 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3