Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P63013

- PRRX1_MOUSE

UniProt

P63013 - PRRX1_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Paired mesoderm homeobox protein 1

Gene

Prrx1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Acts as a transcriptional regulator of muscle creatine kinase (MCK) and so has a role in the establishment of diverse mesodermal muscle types. The protein binds to an A/T-rich element in the muscle creatine enhancer.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
DNA bindingi94 – 15360HomeoboxPROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  1. DNA binding Source: MGI
  2. HMG box domain binding Source: UniProtKB
  3. sequence-specific DNA binding Source: InterPro

GO - Biological processi

  1. artery morphogenesis Source: MGI
  2. cartilage development Source: MGI
  3. embryonic cranial skeleton morphogenesis Source: MGI
  4. embryonic limb morphogenesis Source: MGI
  5. embryonic skeletal system morphogenesis Source: MGI
  6. inner ear morphogenesis Source: MGI
  7. middle ear morphogenesis Source: MGI
  8. negative regulation of transcription from RNA polymerase II promoter Source: Ensembl
  9. palate development Source: MGI
  10. positive regulation of mesenchymal cell proliferation Source: MGI
  11. positive regulation of smoothened signaling pathway Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Ligandi

DNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Paired mesoderm homeobox protein 1
Alternative name(s):
Homeobox protein K-2
Homeobox protein mHox
Paired-related homeobox protein 1
Short name:
PRX-1
Gene namesi
Name:Prrx1
Synonyms:Pmx, Pmx1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 1

Organism-specific databases

MGIiMGI:97712. Prrx1.

Subcellular locationi

GO - Cellular componenti

  1. nucleolus Source: Ensembl
  2. nucleus Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 245245Paired mesoderm homeobox protein 1PRO_0000049252Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei160 – 1601N6-acetyllysine1 Publication
Modified residuei197 – 1971PhosphoserineSequence Analysis

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiP63013.
PRIDEiP63013.

PTM databases

PhosphoSiteiP63013.

Expressioni

Tissue specificityi

Expressed exclusively in mesodermally derived cell types. During embryogenesis, highest levels of expression are found in the mesenchyme and precartilage elements of the face and hind limbs. In the adult, expression is restricted to skeletal muscle, heart and uterus.

Developmental stagei

Expressed during cardiogenesis.

Gene expression databases

BgeeiP63013.
CleanExiMM_PRRX1.
ExpressionAtlasiP63013. baseline and differential.
GenevestigatoriP63013.

Interactioni

Protein-protein interaction databases

BioGridi202269. 2 interactions.
IntActiP63013. 1 interaction.
STRINGi10090.ENSMUSP00000027878.

Structurei

3D structure databases

ProteinModelPortaliP63013.
SMRiP63013. Positions 94-150.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi222 – 23514OARAdd
BLAST

Sequence similaritiesi

Belongs to the paired homeobox family.Curated
Contains 1 homeobox DNA-binding domain.PROSITE-ProRule annotation

Keywords - Domaini

Homeobox

Phylogenomic databases

eggNOGiNOG267226.
GeneTreeiENSGT00760000118958.
HOGENOMiHOG000231518.
HOVERGENiHBG021349.
InParanoidiP63013.
KOiK09329.
OMAiWGSAAPY.
OrthoDBiEOG7DFXD8.
PhylomeDBiP63013.
TreeFamiTF351612.

Family and domain databases

Gene3Di1.10.10.60. 1 hit.
InterProiIPR017970. Homeobox_CS.
IPR001356. Homeobox_dom.
IPR009057. Homeodomain-like.
IPR003654. OAR_dom.
[Graphical view]
PfamiPF00046. Homeobox. 1 hit.
PF03826. OAR. 1 hit.
[Graphical view]
SMARTiSM00389. HOX. 1 hit.
[Graphical view]
SUPFAMiSSF46689. SSF46689. 1 hit.
PROSITEiPS00027. HOMEOBOX_1. 1 hit.
PS50071. HOMEOBOX_2. 1 hit.
PS50803. OAR. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P63013-1) [UniParc]FASTAAdd to Basket

Also known as: K2-a, PMX1-B, Prx1a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTSSYGHVLE RQPALGGRLD SPGNLDTLQA KKNFSVSHLL DLEEAGDMVA
60 70 80 90 100
AQADESVGEA GRSLLESPGL TSGSDTPQQD NDQLNSEEKK KRKQRRNRTT
110 120 130 140 150
FNSSQLQALE RVFERTHYPD AFVREDLARR VNLTEARVQV WFQNRRAKFR
160 170 180 190 200
RNERAMLANK NASLLKSYSG DVTAVEQPIV PRPAPRPTDY LSWGTASPYS
210 220 230 240
AMATYSATCA NNSPAQGINM ANSIANLRLK AKEYSLQRNQ VPTVN
Length:245
Mass (Da):27,269
Last modified:August 31, 2004 - v1
Checksum:iFF867F0D856E1115
GO
Isoform 2 (identifier: P63013-2) [UniParc] [UniParc]FASTAAdd to Basket

Also known as: K2-b, PMX1-A, Prx1b

The sequence of this isoform differs from the canonical sequence as follows:
     200-245: SAMATYSATCANNSPAQGINMANSIANLRLKAKEYSLQRNQVPTVN → RSSSLPRCCLHEGLHNGF

Show »
Length:217
Mass (Da):24,369
Checksum:iA4C1F7A6DF8CE652
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei200 – 24546SAMAT…VPTVN → RSSSLPRCCLHEGLHNGF in isoform 2. 3 PublicationsVSP_002279Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L06502 mRNA. Translation: AAA39672.1.
U03873 mRNA. Translation: AAC52139.1.
X59725 mRNA. Translation: CAA42410.1.
BC092372 mRNA. Translation: AAH92372.1.
CCDSiCCDS15427.1.
CCDS15428.1. [P63013-2]
PIRiI48902.
S26076.
RefSeqiNP_035257.1. NM_011127.2. [P63013-1]
NP_783617.2. NM_175686.3. [P63013-2]
XP_006496766.1. XM_006496703.1. [P63013-2]
UniGeneiMm.288642.

Genome annotation databases

EnsembliENSMUST00000027878; ENSMUSP00000027878; ENSMUSG00000026586. [P63013-1]
ENSMUST00000075805; ENSMUSP00000075203; ENSMUSG00000026586. [P63013-2]
GeneIDi18933.
KEGGimmu:18933.
UCSCiuc007dhh.1. mouse. [P63013-2]
uc007dhi.1. mouse.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L06502 mRNA. Translation: AAA39672.1 .
U03873 mRNA. Translation: AAC52139.1 .
X59725 mRNA. Translation: CAA42410.1 .
BC092372 mRNA. Translation: AAH92372.1 .
CCDSi CCDS15427.1.
CCDS15428.1. [P63013-2 ]
PIRi I48902.
S26076.
RefSeqi NP_035257.1. NM_011127.2. [P63013-1 ]
NP_783617.2. NM_175686.3. [P63013-2 ]
XP_006496766.1. XM_006496703.1. [P63013-2 ]
UniGenei Mm.288642.

3D structure databases

ProteinModelPortali P63013.
SMRi P63013. Positions 94-150.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 202269. 2 interactions.
IntActi P63013. 1 interaction.
STRINGi 10090.ENSMUSP00000027878.

PTM databases

PhosphoSitei P63013.

Proteomic databases

MaxQBi P63013.
PRIDEi P63013.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000027878 ; ENSMUSP00000027878 ; ENSMUSG00000026586 . [P63013-1 ]
ENSMUST00000075805 ; ENSMUSP00000075203 ; ENSMUSG00000026586 . [P63013-2 ]
GeneIDi 18933.
KEGGi mmu:18933.
UCSCi uc007dhh.1. mouse. [P63013-2 ]
uc007dhi.1. mouse.

Organism-specific databases

CTDi 5396.
MGIi MGI:97712. Prrx1.

Phylogenomic databases

eggNOGi NOG267226.
GeneTreei ENSGT00760000118958.
HOGENOMi HOG000231518.
HOVERGENi HBG021349.
InParanoidi P63013.
KOi K09329.
OMAi WGSAAPY.
OrthoDBi EOG7DFXD8.
PhylomeDBi P63013.
TreeFami TF351612.

Miscellaneous databases

NextBioi 295248.
PROi P63013.
SOURCEi Search...

Gene expression databases

Bgeei P63013.
CleanExi MM_PRRX1.
ExpressionAtlasi P63013. baseline and differential.
Genevestigatori P63013.

Family and domain databases

Gene3Di 1.10.10.60. 1 hit.
InterProi IPR017970. Homeobox_CS.
IPR001356. Homeobox_dom.
IPR009057. Homeodomain-like.
IPR003654. OAR_dom.
[Graphical view ]
Pfami PF00046. Homeobox. 1 hit.
PF03826. OAR. 1 hit.
[Graphical view ]
SMARTi SM00389. HOX. 1 hit.
[Graphical view ]
SUPFAMi SSF46689. SSF46689. 1 hit.
PROSITEi PS00027. HOMEOBOX_1. 1 hit.
PS50071. HOMEOBOX_2. 1 hit.
PS50803. OAR. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "MHox: a mesodermally restricted homeodomain protein that binds an essential site in the muscle creatine kinase enhancer."
    Cserjesi P., Lilly B., Bryson L., Wang Y., Sassoon D.A., Olson E.N.
    Development 115:1087-1101(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
  2. "Genomic organization and chromosome localization of the murine homeobox gene Pmx."
    Kern M.J., Argao E.A., Birkenmeier E.H., Rowe L.B., Potter S.S.
    Genomics 19:334-340(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
  3. "A novel murine homeobox gene isolated by a tissue specific PCR cloning strategy."
    Kern M.J., Witte D.P., Valerius M.T., Aronow B.J., Potter S.S.
    Nucleic Acids Res. 20:5189-5195(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Strain: CD-1.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Strain: C57BL/6.
    Tissue: Brain.
  5. "SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways."
    Park J., Chen Y., Tishkoff D.X., Peng C., Tan M., Dai L., Xie Z., Zhang Y., Zwaans B.M., Skinner M.E., Lombard D.B., Zhao Y.
    Mol. Cell 50:919-930(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-160, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Embryonic fibroblast.

Entry informationi

Entry nameiPRRX1_MOUSE
AccessioniPrimary (citable) accession number: P63013
Secondary accession number(s): P43271, Q02810, Q569N6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 31, 2004
Last sequence update: August 31, 2004
Last modified: November 26, 2014
This is version 96 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3