Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Paired mesoderm homeobox protein 1

Gene

Prrx1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Acts as a transcriptional regulator of muscle creatine kinase (MCK) and so has a role in the establishment of diverse mesodermal muscle types. The protein binds to an A/T-rich element in the muscle creatine enhancer.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi94 – 153HomeoboxPROSITE-ProRule annotationAdd BLAST60

GO - Molecular functioni

  • DNA binding Source: MGI
  • HMG box domain binding Source: UniProtKB
  • RNA polymerase II proximal promoter sequence-specific DNA binding Source: NTNU_SB
  • RNA polymerase II transcription coactivator activity Source: MGI
  • transcriptional repressor activity, RNA polymerase II proximal promoter sequence-specific DNA binding Source: NTNU_SB

GO - Biological processi

  • artery morphogenesis Source: MGI
  • cartilage development Source: MGI
  • embryonic cranial skeleton morphogenesis Source: MGI
  • embryonic limb morphogenesis Source: MGI
  • embryonic skeletal system morphogenesis Source: MGI
  • inner ear morphogenesis Source: MGI
  • middle ear morphogenesis Source: MGI
  • negative regulation of transcription by RNA polymerase II Source: NTNU_SB
  • neuronal stem cell population maintenance Source: MGI
  • neuron fate determination Source: MGI
  • positive regulation of mesenchymal cell proliferation Source: MGI
  • positive regulation of smoothened signaling pathway Source: MGI
  • positive regulation of transcription by RNA polymerase II Source: MGI
  • regulation of neuron projection regeneration Source: MGI
  • roof of mouth development Source: MGI

Keywordsi

Molecular functionDevelopmental protein, DNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Paired mesoderm homeobox protein 1
Alternative name(s):
Homeobox protein K-2
Homeobox protein mHox
Paired-related homeobox protein 1
Short name:
PRX-1
Gene namesi
Name:Prrx1
Synonyms:Pmx, Pmx1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 1

Organism-specific databases

MGIiMGI:97712 Prrx1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000492521 – 245Paired mesoderm homeobox protein 1Add BLAST245

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei21PhosphoserineBy similarity1
Modified residuei160N6-acetyllysineCombined sources1
Modified residuei197PhosphoserineSequence analysis1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiP63013
PaxDbiP63013
PRIDEiP63013

PTM databases

iPTMnetiP63013
PhosphoSitePlusiP63013

Expressioni

Tissue specificityi

Expressed exclusively in mesodermally derived cell types. During embryogenesis, highest levels of expression are found in the mesenchyme and precartilage elements of the face and hind limbs. In the adult, expression is restricted to skeletal muscle, heart and uterus.

Developmental stagei

Expressed during cardiogenesis.

Gene expression databases

BgeeiENSMUSG00000026586
CleanExiMM_PRRX1
ExpressionAtlasiP63013 baseline and differential
GenevisibleiP63013 MM

Interactioni

GO - Molecular functioni

  • HMG box domain binding Source: UniProtKB

Protein-protein interaction databases

BioGridi202269, 2 interactors
IntActiP63013, 1 interactor
STRINGi10090.ENSMUSP00000027878

Structurei

3D structure databases

ProteinModelPortaliP63013
SMRiP63013
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi222 – 235OARPROSITE-ProRule annotationAdd BLAST14

Sequence similaritiesi

Belongs to the paired homeobox family.Curated

Keywords - Domaini

Homeobox

Phylogenomic databases

eggNOGiKOG0490 Eukaryota
ENOG410YIJ3 LUCA
GeneTreeiENSGT00920000148948
HOGENOMiHOG000231518
HOVERGENiHBG021349
InParanoidiP63013
KOiK09329
OMAiMATYPPT
OrthoDBiEOG091G0B1L
PhylomeDBiP63013
TreeFamiTF351612

Family and domain databases

CDDicd00086 homeodomain, 1 hit
InterProiView protein in InterPro
IPR009057 Homeobox-like_sf
IPR017970 Homeobox_CS
IPR001356 Homeobox_dom
IPR003654 OAR_dom
PfamiView protein in Pfam
PF00046 Homeobox, 1 hit
PF03826 OAR, 1 hit
SMARTiView protein in SMART
SM00389 HOX, 1 hit
SUPFAMiSSF46689 SSF46689, 1 hit
PROSITEiView protein in PROSITE
PS00027 HOMEOBOX_1, 1 hit
PS50071 HOMEOBOX_2, 1 hit
PS50803 OAR, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P63013-1) [UniParc]FASTAAdd to basket
Also known as: K2-a, PMX1-B, Prx1a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTSSYGHVLE RQPALGGRLD SPGNLDTLQA KKNFSVSHLL DLEEAGDMVA
60 70 80 90 100
AQADESVGEA GRSLLESPGL TSGSDTPQQD NDQLNSEEKK KRKQRRNRTT
110 120 130 140 150
FNSSQLQALE RVFERTHYPD AFVREDLARR VNLTEARVQV WFQNRRAKFR
160 170 180 190 200
RNERAMLANK NASLLKSYSG DVTAVEQPIV PRPAPRPTDY LSWGTASPYS
210 220 230 240
AMATYSATCA NNSPAQGINM ANSIANLRLK AKEYSLQRNQ VPTVN
Length:245
Mass (Da):27,269
Last modified:August 31, 2004 - v1
Checksum:iFF867F0D856E1115
GO
Isoform 2 (identifier: P63013-2) [UniParc] [UniParc]FASTAAdd to basket
Also known as: K2-b, PMX1-A, Prx1b

The sequence of this isoform differs from the canonical sequence as follows:
     200-245: SAMATYSATCANNSPAQGINMANSIANLRLKAKEYSLQRNQVPTVN → RSSSLPRCCLHEGLHNGF

Show »
Length:217
Mass (Da):24,369
Checksum:iA4C1F7A6DF8CE652
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_002279200 – 245SAMAT…VPTVN → RSSSLPRCCLHEGLHNGF in isoform 2. 3 PublicationsAdd BLAST46

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L06502 mRNA Translation: AAA39672.1
U03873 mRNA Translation: AAC52139.1
X59725 mRNA Translation: CAA42410.1
BC092372 mRNA Translation: AAH92372.1
CCDSiCCDS15427.1
CCDS15428.1 [P63013-2]
PIRiI48902
S26076
RefSeqiNP_035257.1, NM_011127.2 [P63013-1]
NP_783617.2, NM_175686.3 [P63013-2]
XP_006496766.1, XM_006496703.3 [P63013-2]
UniGeneiMm.288642

Genome annotation databases

EnsembliENSMUST00000027878; ENSMUSP00000027878; ENSMUSG00000026586 [P63013-1]
ENSMUST00000075805; ENSMUSP00000075203; ENSMUSG00000026586 [P63013-2]
GeneIDi18933
KEGGimmu:18933
UCSCiuc007dhh.1 mouse [P63013-2]
uc007dhi.1 mouse

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiPRRX1_MOUSE
AccessioniPrimary (citable) accession number: P63013
Secondary accession number(s): P43271, Q02810, Q569N6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 31, 2004
Last sequence update: August 31, 2004
Last modified: June 20, 2018
This is version 121 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health