Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P63013 (PRRX1_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 93. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Paired mesoderm homeobox protein 1
Alternative name(s):
Homeobox protein K-2
Homeobox protein mHox
Paired-related homeobox protein 1
Short name=PRX-1
Gene names
Name:Prrx1
Synonyms:Pmx, Pmx1
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length245 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Acts as a transcriptional regulator of muscle creatine kinase (MCK) and so has a role in the establishment of diverse mesodermal muscle types. The protein binds to an A/T-rich element in the muscle creatine enhancer.

Subcellular location

Nucleus.

Tissue specificity

Expressed exclusively in mesodermally derived cell types. During embryogenesis, highest levels of expression are found in the mesenchyme and precartilage elements of the face and hind limbs. In the adult, expression is restricted to skeletal muscle, heart and uterus.

Developmental stage

Expressed during cardiogenesis.

Sequence similarities

Belongs to the paired homeobox family.

Contains 1 homeobox DNA-binding domain.

Ontologies

Keywords
   Cellular componentNucleus
   Coding sequence diversityAlternative splicing
   DomainHomeobox
   LigandDNA-binding
   Molecular functionDevelopmental protein
   PTMAcetylation
Phosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processartery morphogenesis

Inferred from mutant phenotype PubMed 10664157. Source: MGI

cartilage development

Inferred from mutant phenotype PubMed 7758948. Source: MGI

embryonic cranial skeleton morphogenesis

Inferred from mutant phenotype PubMed 7758948. Source: MGI

embryonic limb morphogenesis

Inferred from genetic interaction PubMed 9729491PubMed 9882503. Source: MGI

embryonic skeletal system morphogenesis

Inferred from mutant phenotype PubMed 7758948. Source: MGI

inner ear morphogenesis

Inferred from genetic interaction PubMed 9729491. Source: MGI

middle ear morphogenesis

Inferred from mutant phenotype PubMed 7758948. Source: MGI

negative regulation of transcription from RNA polymerase II promoter

Inferred from electronic annotation. Source: Ensembl

palate development

Inferred from mutant phenotype PubMed 7758948. Source: MGI

positive regulation of mesenchymal cell proliferation

Inferred from genetic interaction PubMed 11532916. Source: MGI

positive regulation of smoothened signaling pathway

Inferred from genetic interaction PubMed 11532916. Source: MGI

   Cellular_componentnucleolus

Inferred from electronic annotation. Source: Ensembl

nucleus

Inferred from direct assay PubMed 11748565. Source: MGI

   Molecular_functionDNA binding

Inferred from direct assay PubMed 15459107. Source: MGI

HMG box domain binding

Inferred from physical interaction PubMed 16582099. Source: UniProtKB

sequence-specific DNA binding

Inferred from electronic annotation. Source: InterPro

sequence-specific DNA binding transcription factor activity

Inferred from electronic annotation. Source: InterPro

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: P63013-1)

Also known as: K2-a; PMX1-B; Prx1a;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: P63013-2)

Also known as: K2-b; PMX1-A; Prx1b;

The sequence of this isoform differs from the canonical sequence as follows:
     200-245: SAMATYSATCANNSPAQGINMANSIANLRLKAKEYSLQRNQVPTVN → RSSSLPRCCLHEGLHNGF

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 245245Paired mesoderm homeobox protein 1
PRO_0000049252

Regions

DNA binding94 – 15360Homeobox
Motif222 – 23514OAR

Amino acid modifications

Modified residue1601N6-acetyllysine Ref.5
Modified residue1971Phosphoserine Potential

Natural variations

Alternative sequence200 – 24546SAMAT…VPTVN → RSSSLPRCCLHEGLHNGF in isoform 2.
VSP_002279

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (K2-a) (PMX1-B) (Prx1a) [UniParc].

Last modified August 31, 2004. Version 1.
Checksum: FF867F0D856E1115

FASTA24527,269
        10         20         30         40         50         60 
MTSSYGHVLE RQPALGGRLD SPGNLDTLQA KKNFSVSHLL DLEEAGDMVA AQADESVGEA 

        70         80         90        100        110        120 
GRSLLESPGL TSGSDTPQQD NDQLNSEEKK KRKQRRNRTT FNSSQLQALE RVFERTHYPD 

       130        140        150        160        170        180 
AFVREDLARR VNLTEARVQV WFQNRRAKFR RNERAMLANK NASLLKSYSG DVTAVEQPIV 

       190        200        210        220        230        240 
PRPAPRPTDY LSWGTASPYS AMATYSATCA NNSPAQGINM ANSIANLRLK AKEYSLQRNQ 


VPTVN 

« Hide

Isoform 2 (K2-b) (PMX1-A) (Prx1b) [UniParc] [UniParc].

Checksum: A4C1F7A6DF8CE652
Show »

FASTA21724,369

References

« Hide 'large scale' references
[1]"MHox: a mesodermally restricted homeodomain protein that binds an essential site in the muscle creatine kinase enhancer."
Cserjesi P., Lilly B., Bryson L., Wang Y., Sassoon D.A., Olson E.N.
Development 115:1087-1101(1992) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
[2]"Genomic organization and chromosome localization of the murine homeobox gene Pmx."
Kern M.J., Argao E.A., Birkenmeier E.H., Rowe L.B., Potter S.S.
Genomics 19:334-340(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
[3]"A novel murine homeobox gene isolated by a tissue specific PCR cloning strategy."
Kern M.J., Witte D.P., Valerius M.T., Aronow B.J., Potter S.S.
Nucleic Acids Res. 20:5189-5195(1992) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Strain: CD-1.
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Strain: C57BL/6.
Tissue: Brain.
[5]"SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways."
Park J., Chen Y., Tishkoff D.X., Peng C., Tan M., Dai L., Xie Z., Zhang Y., Zwaans B.M., Skinner M.E., Lombard D.B., Zhao Y.
Mol. Cell 50:919-930(2013) [PubMed] [Europe PMC] [Abstract]
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-160, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Embryonic fibroblast.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
L06502 mRNA. Translation: AAA39672.1.
U03873 mRNA. Translation: AAC52139.1.
X59725 mRNA. Translation: CAA42410.1.
BC092372 mRNA. Translation: AAH92372.1.
CCDSCCDS15427.1.
CCDS15428.1. [P63013-2]
PIRI48902.
S26076.
RefSeqNP_035257.1. NM_011127.2. [P63013-1]
NP_783617.2. NM_175686.3. [P63013-2]
XP_006496766.1. XM_006496703.1. [P63013-2]
UniGeneMm.288642.

3D structure databases

ProteinModelPortalP63013.
SMRP63013. Positions 94-150.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid202269. 2 interactions.
IntActP63013. 1 interaction.
STRING10090.ENSMUSP00000027878.

PTM databases

PhosphoSiteP63013.

Proteomic databases

PRIDEP63013.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000027878; ENSMUSP00000027878; ENSMUSG00000026586. [P63013-1]
ENSMUST00000075805; ENSMUSP00000075203; ENSMUSG00000026586. [P63013-2]
GeneID18933.
KEGGmmu:18933.
UCSCuc007dhh.1. mouse. [P63013-2]
uc007dhi.1. mouse.

Organism-specific databases

CTD5396.
MGIMGI:97712. Prrx1.

Phylogenomic databases

eggNOGNOG267226.
GeneTreeENSGT00750000117349.
HOGENOMHOG000231518.
HOVERGENHBG021349.
InParanoidP63013.
KOK09329.
OMAWGSAAPY.
OrthoDBEOG7DFXD8.
PhylomeDBP63013.
TreeFamTF351612.

Gene expression databases

ArrayExpressP63013.
BgeeP63013.
CleanExMM_PRRX1.
GenevestigatorP63013.

Family and domain databases

Gene3D1.10.10.60. 1 hit.
InterProIPR017970. Homeobox_CS.
IPR001356. Homeobox_dom.
IPR009057. Homeodomain-like.
IPR003654. OAR_dom.
[Graphical view]
PfamPF00046. Homeobox. 1 hit.
PF03826. OAR. 1 hit.
[Graphical view]
SMARTSM00389. HOX. 1 hit.
[Graphical view]
SUPFAMSSF46689. SSF46689. 1 hit.
PROSITEPS00027. HOMEOBOX_1. 1 hit.
PS50071. HOMEOBOX_2. 1 hit.
PS50803. OAR. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSPRRX1. mouse.
NextBio295248.
PROP63013.
SOURCESearch...

Entry information

Entry namePRRX1_MOUSE
AccessionPrimary (citable) accession number: P63013
Secondary accession number(s): P43271, Q02810, Q569N6
Entry history
Integrated into UniProtKB/Swiss-Prot: August 31, 2004
Last sequence update: August 31, 2004
Last modified: July 9, 2014
This is version 93 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot