ID CCG7_HUMAN Reviewed; 275 AA. AC P62955; Q52LL8; Q8VBX3; Q8WXS6; Q9BXT1; DT 31-AUG-2004, integrated into UniProtKB/Swiss-Prot. DT 31-AUG-2004, sequence version 1. DT 21-SEP-2011, entry version 66. DE RecName: Full=Voltage-dependent calcium channel gamma-7 subunit; DE AltName: Full=Neuronal voltage-gated calcium channel gamma-7 subunit; DE AltName: Full=Transmembrane AMPAR regulatory protein gamma-7; DE Short=TARP gamma-7; GN Name=CACNG7; OS Homo sapiens (Human). OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; OC Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; OC Catarrhini; Hominidae; Homo. OX NCBI_TaxID=9606; RN [1] RP NUCLEOTIDE SEQUENCE [MRNA], AND TISSUE SPECIFICITY. RX MEDLINE=21100909; PubMed=11170751; DOI=10.1006/geno.2000.6440; RA Burgess D.L., Gefrides L.A., Foreman P.J., Noebels J.L.; RT "A cluster of three novel Ca(2+) channel gamma subunit genes on RT chromosome 19q13.4: evolution and expression profile of the gamma RT subunit gene family."; RL Genomics 71:339-350(2001). RN [2] RP NUCLEOTIDE SEQUENCE [MRNA]. RX MEDLINE=21601102; PubMed=11738816; DOI=10.1016/S0378-1119(01)00738-7; RA Chu P.-J., Robertson H.M., Best P.M.; RT "Calcium channel gamma subunits provide insights into the evolution of RT this gene family."; RL Gene 280:37-48(2001). RN [3] RP NUCLEOTIDE SEQUENCE [MRNA]. RX MEDLINE=21924683; PubMed=11927536; DOI=10.1093/emboj/21.7.1514; RA Moss F.J., Viard P., Davies A., Bertaso F., Page K.M., Graham A., RA Canti C., Plumpton M., Plumpton C., Clare J.J., Dolphin A.C.; RT "The novel product of a five-exon stargazin-related gene abolishes RT CaV2.2 calcium channel expression."; RL EMBO J. 21:1514-1523(2002). RN [4] RP NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]. RC TISSUE=Brain; RX PubMed=15489334; DOI=10.1101/gr.2596504; RG The MGC Project Team; RT "The status, quality, and expansion of the NIH full-length cDNA RT project: the Mammalian Gene Collection (MGC)."; RL Genome Res. 14:2121-2127(2004). RN [5] RP PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-258 AND TYR-264, AND RP MASS SPECTROMETRY. RC TISSUE=Embryonic kidney; RX PubMed=17053785; DOI=10.1038/sj.emboj.7601384; RA Wang Y., Du D., Fang L., Yang G., Zhang C., Zeng R., Ullrich A., RA Lottspeich F., Chen Z.; RT "Tyrosine phosphorylated Par3 regulates epithelial tight junction RT assembly promoted by EGFR signaling."; RL EMBO J. 25:5058-5070(2006). RN [6] RP FUNCTION. RX PubMed=21172611; DOI=10.1016/j.neuron.2010.11.026; RA Kato A.S., Gill M.B., Ho M.T., Yu H., Tu Y., Siuda E.R., Wang H., RA Qian Y.W., Nisenbaum E.S., Tomita S., Bredt D.S.; RT "Hippocampal AMPA receptor gating controlled by both TARP and RT cornichon proteins."; RL Neuron 68:1082-1096(2010). CC -!- FUNCTION: Regulates the trafficking and gating properties of AMPA- CC selective glutamate receptors (AMPARs). Promotes their targeting CC to the cell membrane and synapses and modulates their gating CC properties by slowing their rates of activation, deactivation and CC desensitization and by mediating their resensitization. Displays CC subunit-specific AMPA receptor regulation. Shows specificity only CC for GRIA1 and GRIA2. Thought to stabilize the calcium channel in CC an inactivated (closed) state. CC -!- SUBUNIT: The L-type calcium channel is composed of five subunits: CC alpha-1, alpha-2/delta, beta and gamma. Acts as an auxiliary CC subunit for AMPA-selective glutamate receptors (AMPARs). Found in CC a complex with GRIA1, GRIA2, GRIA3, GRIA4, CNIH2, CNIH3, CACNG2, CC CACNG3, CACNG4, CACNG5 and CACNG8. CC -!- SUBCELLULAR LOCATION: Membrane; Multi-pass membrane protein (By CC similarity). CC -!- TISSUE SPECIFICITY: Widely expressed. CC -!- SIMILARITY: Belongs to the PMP-22/EMP/MP20 family. CACNG CC subfamily. CC --------------------------------------------------------------------------- CC Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms CC Distributed under the Creative Commons Attribution (CC BY 4.0) License CC --------------------------------------------------------------------------- DR EMBL; AF288387; AAK20030.1; -; mRNA. DR EMBL; AF361353; AAL50048.1; -; mRNA. DR EMBL; AF458897; AAM00594.1; -; mRNA. DR EMBL; BC069332; AAH69332.1; -; mRNA. DR EMBL; BC093869; AAH93869.1; -; mRNA. DR EMBL; BC113503; AAI13504.1; -; mRNA. DR IPI; IPI00011071; -. DR RefSeq; NP_114102.2; NM_031896.4. DR UniGene; Hs.631597; -. DR ProteinModelPortal; P62955; -. DR STRING; P62955; -. DR TCDB; 8.A.16.2.5; Ca+ channel auxiliary subunit gamma1-gamma8 (CCAgamma) family. DR PhosphoSite; P62955; -. DR PRIDE; P62955; -. DR Ensembl; ENST00000222212; ENSP00000222212; ENSG00000105605. DR Ensembl; ENST00000391767; ENSP00000375647; ENSG00000105605. DR GeneID; 59284; -. DR KEGG; hsa:59284; -. DR UCSC; uc002qcr.1; human. DR CTD; 59284; -. DR GeneCards; GC19P050735; -. DR H-InvDB; HIX0039988; -. DR HGNC; HGNC:13626; CACNG7. DR MIM; 606899; gene. DR neXtProt; NX_P62955; -. DR PharmGKB; PA26021; -. DR eggNOG; prNOG15309; -. DR GeneTree; ENSGT00550000074547; -. DR HOGENOM; HBG446234; -. DR HOVERGEN; HBG025923; -. DR InParanoid; P62955; -. DR OMA; FSTRALT; -. DR OrthoDB; EOG40S0G8; -. DR PhylomeDB; P62955; -. DR NextBio; 65174; -. DR ArrayExpress; P62955; -. DR Bgee; P62955; -. DR CleanEx; HS_CACNG7; -. DR Genevestigator; P62955; -. DR GermOnline; ENSG00000105605; Homo sapiens. DR GO; GO:0032281; C:alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid selective glutamate receptor complex; ISS:UniProtKB. DR GO; GO:0005891; C:voltage-gated calcium channel complex; NAS:UniProtKB. DR GO; GO:0005245; F:voltage-gated calcium channel activity; NAS:UniProtKB. DR GO; GO:2000311; P:regulation of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activity; IDA:UniProtKB. DR InterPro; IPR004031; PMP22/EMP/MP20/Claudin. DR InterPro; IPR008371; VDCC_g7su. DR InterPro; IPR008368; VDCC_gsu. DR Pfam; PF00822; PMP22_Claudin; 1. DR PRINTS; PR01792; VDCCGAMMA. DR PRINTS; PR01795; VDCCGAMMA7. PE 1: Evidence at protein level; KW Calcium; Calcium channel; Calcium transport; Complete proteome; KW Ion transport; Ionic channel; Membrane; Phosphoprotein; KW Reference proteome; Transmembrane; Transmembrane helix; Transport; KW Voltage-gated channel. FT CHAIN 1 275 Voltage-dependent calcium channel gamma-7 FT subunit. FT /FTId=PRO_0000164687. FT TRANSMEM 8 28 Helical; (Potential). FT TRANSMEM 103 123 Helical; (Potential). FT TRANSMEM 129 149 Helical; (Potential). FT TRANSMEM 179 199 Helical; (Potential). FT MOD_RES 258 258 Phosphotyrosine. FT MOD_RES 264 264 Phosphotyrosine. FT CONFLICT 191 275 GAGVMSVYLFTKRYAEEEMYRPHPAFYRPRLSDCSDYSGQF FT LQPEAWRRGRSPSDISSDVSIQMTQNYPPAIKYPDHLHIST FT SPC -> VTSVGPRL (in Ref. 1; AAK20030). SQ SEQUENCE 275 AA; 31003 MW; 43CC82B9FA6A5C73 CRC64; MSHCSSRALT LLSSVFGACG LLLVGIAVST DYWLYMEEGT VLPQNQTTEV KMALHAGLWR VCFFAGREKG RCVASEYFLE PEINLVTENT ENILKTVRTA TPFPMVSLFL VFTAFVISNI GHIRPQRTIL AFVSGIFFIL SGLSLVVGLV LYISSINDEV MNRPSSSEQY FHYRYGWSFA FAASSFLLKE GAGVMSVYLF TKRYAEEEMY RPHPAFYRPR LSDCSDYSGQ FLQPEAWRRG RSPSDISSDV SIQMTQNYPP AIKYPDHLHI STSPC //