P62139 (PP1A_RABIT) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 82.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Serine/threonine-protein phosphatase PP1-alpha catalytic subunit Short name=PP-1A EC=3.1.3.16 | ||||
| Gene names |
| ||||
| Organism | Oryctolagus cuniculus (Rabbit) [Reference proteome] | ||||
| Taxonomic identifier | 9986 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Lagomorpha › Leporidae › Oryctolagus![]() |
Protein attributes
| Sequence length | 330 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Protein phosphatase that associates with over 200 regulatory proteins to form highly specific holoenzymes which dephosphorylate hundreds of biological targets. Protein phosphatase 1 (PP1) is essential for cell division, and participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Involved in regulation of ionic conductances and long-term synaptic plasticity. May play an important role in dephosphorylating substrates such as the postsynaptic density-associated Ca2+/calmodulin dependent protein kinase II. Component of the PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase. Regulates NEK2 function in terms of kinase activity and centrosome number and splitting, both in the presence and absence of radiation-induced DNA damage. Regulator of neural tube and optic fissure closure, and enteric neural crest cell (ENCCs) migration during development By similarity. |
| Catalytic activity | A phosphoprotein + H2O = a protein + phosphate. |
| Cofactor | Binds 1 iron ion per subunit. Binds 1 manganese ion per subunit. |
| Subunit structure | PP1 comprises a catalytic subunit, PPP1CA, PPP1CB or PPP1CC, which is folded into its native form by inhibitor 2 and glycogen synthetase kinase 3, and then complexed to one or several targeting or regulatory subunits. PPP1R12A, PPP1R12B and PPP1R12C mediate binding to myosin. PPP1R3A (in skeletal muscle), PPP1R3B (in liver), PPP1R3C, PPP1R3D and PPP1R3F (in brain) mediate binding to glycogen. Interacts with PPP1R15A and PPP1R15B; the interactions mediate binding to EIF2S1. Part of a complex containing PPP1R15B, PP1 and NCK1/2. Component of the MLL5-L complex, at least composed of MLL5, STK38, PPP1CA, PPP1CB, PPP1CC, HCFC1, ACTB and OGT. Interacts with PPP1R9A, PPP1R9B and PPP1R7. Interacts with YLPM1. Forms a complex with ILF2, ILF3, YLPM1, KHDRBS1, RBMX and NCOA5. Interacts with NOM1 and PPP1R8. Interacts with PPP1R16B. Interacts with RPSA only in the presence of PPP1R16B. Component of the PTW/PP1 phosphatase complex, composed of PPP1R10/PNUTS, TOX4, WDR82, and PPP1CA or PPP1CB or PPP1CC. Interacts with PPP1R10/PNUTS and PPP1R8. Interacts with WDR82 in the presence of PPP1R10/PNUTS. Interacts with TRIM28; the interaction dephosphorylates TRIM28 on 'Ser-824' and forms a complex at the p21 promoter site By similarity. Interacts with PPP1R39. Interacts with NEK2. Interacts with PHACTR4; which acts as an activator of PP1 activity. Interacts with FER; this promotes phosphorylation at Thr-320 By similarity. Ref.5 |
| Subcellular location | Cytoplasm By similarity. Nucleus By similarity. Nucleus › nucleoplasm By similarity. Nucleus › nucleolus By similarity. Note: Primarily nuclear and largely excluded from the nucleolus. Highly mobile in cells and can be relocalized through interaction with targeting subunits. NOM1 plays a role in targeting this protein to the nucleolus. In the presence of PPP1R8 relocalizes from the nucleus to nuclear speckles By similarity. |
| Post-translational modification | Phosphorylated. Dephosphorylated at Thr-320 in the presence of ionizing radiation By similarity. |
| Sequence similarities | Belongs to the PPP phosphatase family. PP-1 subfamily. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 2 (identifier: P62139-1) Also known as: 1-alpha-2; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1 (identifier: P62139-2) Also known as: 1-alpha-1; The sequence of this isoform differs from the canonical sequence as follows: 1-33: MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTEN → MVTIMTTSEYLSGY | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 2 – 330 | 329 | Serine/threonine-protein phosphatase PP1-alpha catalytic subunit | PRO_0000058776 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 125 | 1 | Proton donor By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 64 | 1 | Iron | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 66 | 1 | Iron | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 92 | 1 | Iron | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 92 | 1 | Manganese | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 124 | 1 | Manganese | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 173 | 1 | Manganese | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 248 | 1 | Manganese | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 2 | 1 | N-acetylserine By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 306 | 1 | Phosphotyrosine By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 320 | 1 | Phosphothreonine By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 33 | 33 | MSDSE…QLTEN → MVTIMTTSEYLSGY in isoform 1. | VSP_010642 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 309 | 1 | F → L in CAA68693. Ref.1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 309 | 1 | F → L in CAA30645. Ref.3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 9 – 18 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 19 – 22 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 32 – 48 | 17 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 51 – 55 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 57 – 62 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 69 – 79 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 87 – 89 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 94 – 98 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 100 – 113 | 14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 115 – 117 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 118 – 120 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 128 – 134 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 136 – 143 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 146 – 156 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 162 – 165 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 166 – 168 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 169 – 174 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 183 – 188 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 197 – 199 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 200 – 206 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 214 – 218 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 222 – 227 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 229 – 239 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 242 – 246 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 254 – 258 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 259 – 262 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 263 – 267 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 274 – 276 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 280 – 285 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 291 – 296 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "Isolation and sequence analysis of a cDNA clone encoding a type-1 protein phosphatase catalytic subunit: homology with protein phosphatase 2A." Berndt N., Campbell D.G., Caudwell F.B., Cohen P., da Cruz e Silva E.F., da Cruz e Silva O.B., Cohen P.T.W. FEBS Lett. 223:340-346(1987) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Strain: New Zealand white. Tissue: Skeletal muscle. |
| [2] | "Molecular cloning of a cDNA for the catalytic subunit of rabbit muscle phosphorylase phosphatase." Bai G., Zhang Z., Amin J., Deans-Zirattu S.A., Lee E.Y.C. FASEB J. 2:3010-3016(1988) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Tissue: Muscle. |
| [3] | "Two isoforms of protein phosphatase 1 may be produced from the same gene." Cohen P.T.W. FEBS Lett. 232:17-23(1988) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Strain: New Zealand white. Tissue: Skeletal muscle. |
| [4] | "The major type-1 protein phosphatase catalytic subunits are the same gene products in rabbit skeletal muscle and rabbit liver." Cohen P.T.W., Schelling D.L., da Cruz e Silva O.B., Barker H.M., Cohen P. Biochim. Biophys. Acta 1008:125-128(1989) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Strain: New Zealand white. Tissue: Liver. |
| [5] | "FLJ23654 encodes a heart protein phosphatase 1-binding protein (Hepp1)." Chen C.Y., Lai N.S., Yang J.J., Huang H.L., Hung W.C., Li C., Lin T.H., Huang H.B. Biochem. Biophys. Res. Commun. 391:698-702(2010) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH PPP1R39. |
| [6] | "Three-dimensional structure of the catalytic subunit of protein serine/threonine phosphatase-1." Goldberg J., Huang H.B., Kwon Y.G., Greengard P., Nairn A.C., Kuriyan J. Nature 376:745-753(1995) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.1 ANGSTROMS). |
Web resources
| Protein Spotlight The things we forget - Issue 32 of March 2003 |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | Y00701 mRNA. Translation: CAA68693.1. X07798 mRNA. Translation: CAA30645.1. X14832 mRNA. Translation: CAA32941.1. | ||||||||||||
| PIR | PARB11. S04335. | ||||||||||||
| RefSeq | NP_001095176.1. NM_001101706.1. | ||||||||||||
| UniGene | Ocu.2075. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | P62139. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | P62139. 1 interaction. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | P62139. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| GeneID | 100009298. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 5499. | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | COG0639. | ||||||||||||
| HOVERGEN | HBG000216. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR004843. Metallo_PEstase_dom. IPR006186. Ser/Thr-sp_prot-phosphatase. [Graphical view] | ||||||||||||
| Pfam | PF00149. Metallophos. 1 hit. [Graphical view] | ||||||||||||
| PRINTS | PR00114. STPHPHTASE. | ||||||||||||
| SMART | SM00156. PP2Ac. 1 hit. [Graphical view] | ||||||||||||
| PROSITE | PS00125. SER_THR_PHOSPHATASE. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| BindingDB | P62139. | ||||||||||||
| ChEMBL | CHEMBL5458. | ||||||||||||
| EvolutionaryTrace | P62139. | ||||||||||||
Entry information
| Entry name | PP1A_RABIT | ||||||||
| Accession | Primary (citable) accession number: P62139 Secondary accession number(s): P08128 P22802 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |
| Protein Spotlight Protein Spotlight articles and cited UniProtKB/Swiss-Prot entries |

Clusters with
