Reviewed,
UniProtKB/Swiss-Prot P62139 (PP1A_RABIT)
Last modified
November 24, 2009.
Version 56.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Serine/threonine-protein phosphatase PP1-alpha catalytic subunit Short name=PP-1A EC=3.1.3.16 | ||||
| Gene names |
| ||||
| Organism | Oryctolagus cuniculus (Rabbit) | ||||
| Taxonomic identifier | 9986 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Lagomorpha › Leporidae › Oryctolagus |
Protein attributes
| Sequence length | 330 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Protein phosphatase 1 (PP1) is essential for cell division, and participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Involved in regulation of ionic conductances and long-term synaptic plasticity. May play an important role in dephosphorylating substrates such as the postsynaptic density-associated Ca2+/calmodulin dependent protein kinase II. |
| Catalytic activity | A phosphoprotein + H2O = a protein + phosphate. |
| Cofactor | Binds 1 iron ion per subunit. Binds 1 manganese ion per subunit. |
| Subunit structure | PP1 comprises a catalytic subunit, PPP1CA, PPP1CB or PPP1CC, which is folded into its native form by inhibitor 2 and glycogen synthetase kinase 3, and then complexed to one or several targeting or regulatory subunits. PPP1R12A, PPP1R12B and PPP1R12C mediate binding to myosin. PPP1R3A, PPP1R3B, PPP1R3C and PPP1R3D mediate binding to glycogen. PPP1R15A and PPP1R15B mediate binding to EIF2S1. Part of a complex containing PPP1R15B, PP1 and NCK1/2. Component of the MLL5-L complex, at least composed of MLL5, STK38, PPP1CA, PPP1CB, PPP1CC, HCFC1, ACTB and OGT. Interacts with PPP1R9A, PPP1R9B and PPP1R7. Interacts with YLPM1. Forms a complex with ILF2, ILF3, YLPM1, KHDRBS1, RBMX and NCOA5. Interacts with NOM1 and PPP1R8 By similarity. |
| Subcellular location | Cytoplasm By similarity. Nucleus By similarity. Nucleus › nucleoplasm By similarity. Nucleus › nucleolus By similarity. Note: Primarily nuclear and largely excluded from the nucleolus. Highly mobile in cells and can be relocalized through interaction with targeting subunits. NOM1 plays a role in targeting this protein to the nucleolus. In the presence of PPP1R8 relocalizes from the nucleus to nuclear speckles By similarity. |
| Sequence similarities | Belongs to the PPP phosphatase family. PP-1 subfamily. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| LMTK2 | Q8IWU2 | 1 | EBI-2008988,EBI-2008933 | From a different organism. |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 2 (identifier: P62139-1) Also known as: 1-alpha-2; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1 (identifier: P62139-2) Also known as: 1-alpha-1; The sequence of this isoform differs from the canonical sequence as follows: 1-33: MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTEN → MVTIMTTSEYLSGY | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 2 – 330 | 329 | Serine/threonine-protein phosphatase PP1-alpha catalytic subunit | PRO_0000058776 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 125 | 1 | Proton donor By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 64 | 1 | Iron | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 66 | 1 | Iron | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 92 | 1 | Iron | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 92 | 1 | Manganese | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 124 | 1 | Manganese | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 173 | 1 | Manganese | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 248 | 1 | Manganese | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 2 | 1 | N-acetylserine By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 306 | 1 | Phosphotyrosine By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 320 | 1 | Phosphothreonine By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 33 | 33 | MSDSE…QLTEN → MVTIMTTSEYLSGY in isoform 1. | VSP_010642 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 309 | 1 | F → L in CAA68693. Ref.1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 309 | 1 | F → L in CAA30645. Ref.3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 9 – 18 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 19 – 22 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 32 – 48 | 17 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 51 – 55 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 57 – 62 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 69 – 79 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 87 – 89 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 94 – 98 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 100 – 113 | 14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 115 – 117 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 118 – 120 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 128 – 134 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 136 – 143 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 146 – 156 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 162 – 165 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 166 – 168 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 169 – 174 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 183 – 188 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 197 – 199 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 200 – 206 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 214 – 218 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 222 – 227 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 229 – 239 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 242 – 246 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 254 – 258 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 259 – 262 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 263 – 267 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 274 – 276 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 280 – 285 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 291 – 296 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "Isolation and sequence analysis of a cDNA clone encoding a type-1 protein phosphatase catalytic subunit: homology with protein phosphatase 2A." Berndt N., Campbell D.G., Caudwell F.B., Cohen P., da Cruz e Silva E.F., da Cruz e Silva O.B., Cohen P.T.W. FEBS Lett. 223:340-346(1987) [PubMed: 2822491] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Strain: New Zealand white. Tissue: Skeletal muscle. |
| [2] | "Molecular cloning of a cDNA for the catalytic subunit of rabbit muscle phosphorylase phosphatase." Bai G., Zhang Z., Amin J., Deans-Zirattu S.A., Lee E.Y.C. FASEB J. 2:3010-3016(1988) [PubMed: 2846396] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Tissue: Muscle. |
| [3] | "Two isoforms of protein phosphatase 1 may be produced from the same gene." Cohen P.T.W. FEBS Lett. 232:17-23(1988) [PubMed: 2835264] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Strain: New Zealand white. Tissue: Skeletal muscle. |
| [4] | "The major type-1 protein phosphatase catalytic subunits are the same gene products in rabbit skeletal muscle and rabbit liver." Cohen P.T.W., Schelling D.L., da Cruz e Silva O.B., Barker H.M., Cohen P. Biochim. Biophys. Acta 1008:125-128(1989) [PubMed: 2541784] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Strain: New Zealand white. Tissue: Liver. |
| [5] | "Three-dimensional structure of the catalytic subunit of protein serine/threonine phosphatase-1." Goldberg J., Huang H.B., Kwon Y.G., Greengard P., Nairn A.C., Kuriyan J. Nature 376:745-753(1995) [PubMed: 7651533] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.1 ANGSTROMS). |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Y00701 mRNA. Translation: CAA68693.1. X07798 mRNA. Translation: CAA30645.1. X14832 mRNA. Translation: CAA32941.1. | |||||||||||||
| PIR | PARB11. S04335. | ||||||||||||
| RefSeq | NP_001095176.1. | ||||||||||||
| UniGene | Ocu.2075 | ||||||||||||
3D structure databases | |||||||||||||
| |||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | P62139. 1 interaction. | ||||||||||||
Genome annotation databases | |||||||||||||
| GeneID | 100009298. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 100009298. | ||||||||||||
Phylogenomic databases | |||||||||||||
| HOVERGEN | P62139. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| BRENDA | 3.1.3.16. 255. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR004843. M-pesterase. IPR006186. Ser/Thr-sp_prot-phosphatase. [Graphical view] | ||||||||||||
| PANTHER | PTHR11668. T_phtase_apaH. 1 hit. | ||||||||||||
| Pfam | PF00149. Metallophos. 1 hit. [Graphical view] | ||||||||||||
| PRINTS | PR00114. STPHPHTASE. | ||||||||||||
| SMART | SM00156. PP2Ac. 1 hit. [Graphical view] | ||||||||||||
| PROSITE | PS00125. SER_THR_PHOSPHATASE. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Entry information
| Entry name | PP1A_RABIT | ||||||||
| Accession | Primary (citable) accession number: P62139 Secondary accession number(s): P08128 P22802 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| Protein Spotlight Protein Spotlight articles and cited UniProtKB/Swiss-Prot entries |
| SIMILARITY comments Index of protein domains and families |

Clusters with


