Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P62070

- RRAS2_HUMAN

UniProt

P62070 - RRAS2_HUMAN

Protein

Ras-related protein R-Ras2

Gene

RRAS2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 123 (01 Oct 2014)
      Sequence version 1 (21 Jun 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    It is a plasma membrane-associated GTP-binding protein with GTPase activity. Might transduce growth inhibitory signals across the cell membrane, exerting its effect through an effector shared with the Ras proteins but in an antagonistic fashion.

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi21 – 299GTP
    Nucleotide bindingi68 – 725GTPBy similarity
    Nucleotide bindingi127 – 1304GTP
    Nucleotide bindingi157 – 1593GTP

    GO - Molecular functioni

    1. GTPase activity Source: ProtInc
    2. GTP binding Source: UniProtKB-KW
    3. protein binding Source: IntAct

    GO - Biological processi

    1. GTP catabolic process Source: InterPro
    2. osteoblast differentiation Source: UniProt
    3. positive regulation of cell migration Source: Ensembl
    4. Ras protein signal transduction Source: Ensembl
    5. small GTPase mediated signal transduction Source: InterPro

    Keywords - Ligandi

    GTP-binding, Nucleotide-binding

    Enzyme and pathway databases

    SignaLinkiP62070.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Ras-related protein R-Ras2
    Alternative name(s):
    Ras-like protein TC21
    Teratocarcinoma oncogene
    Gene namesi
    Name:RRAS2
    Synonyms:TC21
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 11

    Organism-specific databases

    HGNCiHGNC:17271. RRAS2.

    Subcellular locationi

    Cell membrane By similarity; Lipid-anchor By similarity; Cytoplasmic side By similarity
    Note: Inner surface of plasma membrane possibly with attachment requiring acylation of the C-terminal cysteine (By similarity with RAS).

    GO - Cellular componenti

    1. endoplasmic reticulum Source: ProtInc
    2. extracellular vesicular exosome Source: UniProt
    3. membrane Source: UniProt
    4. plasma membrane Source: ProtInc

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Involvement in diseasei

    Ovarian cancer (OC) [MIM:167000]: The term ovarian cancer defines malignancies originating from ovarian tissue. Although many histologic types of ovarian tumors have been described, epithelial ovarian carcinoma is the most common form. Ovarian cancers are often asymptomatic and the recognized signs and symptoms, even of late-stage disease, are vague. Consequently, most patients are diagnosed with advanced disease.1 Publication
    Note: Disease susceptibility is associated with variations affecting the gene represented in this entry.

    Keywords - Diseasei

    Disease mutation, Proto-oncogene

    Organism-specific databases

    MIMi167000. phenotype.
    PharmGKBiPA34862.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Initiator methioninei1 – 11Removed1 Publication
    Chaini2 – 201200Ras-related protein R-Ras2PRO_0000082652Add
    BLAST
    Propeptidei202 – 2043Removed in mature formBy similarityPRO_0000281302

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei2 – 21N-acetylalanine1 Publication
    Modified residuei186 – 1861Phosphoserine5 Publications
    Lipidationi199 – 1991S-palmitoyl cysteineSequence Analysis
    Modified residuei201 – 2011Cysteine methyl esterCurated
    Lipidationi201 – 2011S-farnesyl cysteine1 Publication

    Post-translational modificationi

    May be post-translationally modified by both palmitoylation and polyisoprenylation.

    Keywords - PTMi

    Acetylation, Lipoprotein, Methylation, Palmitate, Phosphoprotein, Prenylation

    Proteomic databases

    MaxQBiP62070.
    PaxDbiP62070.
    PeptideAtlasiP62070.
    PRIDEiP62070.

    PTM databases

    PhosphoSiteiP62070.

    Expressioni

    Tissue specificityi

    Ubiquitously present in all tissues examined, with the highest levels in heart, placenta, and skeletal muscle. Moderate levels in lung and liver; low levels in brain, kidney, and pancreas.1 Publication

    Gene expression databases

    ArrayExpressiP62070.
    BgeeiP62070.
    CleanExiHS_RRAS2.
    GenevestigatoriP62070.

    Organism-specific databases

    HPAiCAB010420.

    Interactioni

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    ARAFP103983EBI-491037,EBI-365961

    Protein-protein interaction databases

    BioGridi116480. 15 interactions.
    IntActiP62070. 14 interactions.
    MINTiMINT-5001153.
    STRINGi9606.ENSP00000256196.

    Structurei

    Secondary structure

    1
    204
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi14 – 218
    Helixi27 – 3610
    Beta strandi49 – 579
    Beta strandi60 – 689
    Helixi77 – 859
    Beta strandi87 – 948
    Helixi98 – 1025
    Helixi104 – 11512
    Beta strandi121 – 1277
    Helixi139 – 14810
    Beta strandi152 – 1554
    Turni158 – 1614
    Helixi164 – 17815

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2ERYX-ray1.70A/B12-181[»]
    ProteinModelPortaliP62070.
    SMRiP62070. Positions 13-181.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiP62070.

    Family & Domainsi

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi43 – 519Effector region

    Sequence similaritiesi

    Belongs to the small GTPase superfamily. Ras family.Curated

    Phylogenomic databases

    eggNOGiCOG1100.
    HOGENOMiHOG000233973.
    HOVERGENiHBG009351.
    InParanoidiP62070.
    KOiK07830.
    OMAiXKFQEQE.
    PhylomeDBiP62070.
    TreeFamiTF312796.

    Family and domain databases

    Gene3Di3.40.50.300. 1 hit.
    InterProiIPR027417. P-loop_NTPase.
    IPR005225. Small_GTP-bd_dom.
    IPR001806. Small_GTPase.
    IPR020849. Small_GTPase_Ras.
    [Graphical view]
    PANTHERiPTHR24070. PTHR24070. 1 hit.
    PfamiPF00071. Ras. 1 hit.
    [Graphical view]
    PRINTSiPR00449. RASTRNSFRMNG.
    SMARTiSM00173. RAS. 1 hit.
    [Graphical view]
    SUPFAMiSSF52540. SSF52540. 1 hit.
    TIGRFAMsiTIGR00231. small_GTP. 1 hit.
    PROSITEiPS51421. RAS. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P62070-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAAAGWRDGS GQEKYRLVVV GGGGVGKSAL TIQFIQSYFV TDYDPTIEDS    50
    YTKQCVIDDR AARLDILDTA GQEEFGAMRE QYMRTGEGFL LVFSVTDRGS 100
    FEEIYKFQRQ ILRVKDRDEF PMILIGNKAD LDHQRQVTQE EGQQLARQLK 150
    VTYMEASAKI RMNVDQAFHE LVRVIRKFQE QECPPSPEPT RKEKDKKGCH 200
    CVIF 204
    Length:204
    Mass (Da):23,400
    Last modified:June 21, 2004 - v1
    Checksum:iBA7D4759DC49446F
    GO
    Isoform 2 (identifier: P62070-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-77: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:127
    Mass (Da):15,094
    Checksum:i58F3090C7A5F9B60
    GO
    Isoform 3 (identifier: P62070-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-36: MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQ → M

    Note: No experimental confirmation available.

    Show »
    Length:169
    Mass (Da):19,841
    Checksum:iA9C28F683B9E5A63
    GO
    Isoform 4 (identifier: P62070-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         36-36: Q → QFFLFLQ

    Note: No experimental confirmation available.

    Show »
    Length:210
    Mass (Da):24,196
    Checksum:i881713C4D54A663E
    GO

    Sequence cautioni

    The sequence AAA36545.1 differs from that shown. Reason: Frameshift at positions 4, 8 and 12.
    The sequence AAM12638.1 differs from that shown. Reason: Frameshift at positions 4, 8 and 12.

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti72 – 721Q → L in an ovarian cancer sample; somatic mutation. 1 Publication
    VAR_006848

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 7777Missing in isoform 2. 1 PublicationVSP_043066Add
    BLAST
    Alternative sequencei1 – 3636MAAAG…IQFIQ → M in isoform 3. 1 PublicationVSP_044485Add
    BLAST
    Alternative sequencei36 – 361Q → QFFLFLQ in isoform 4. 1 PublicationVSP_055842

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M31468 mRNA. Translation: AAA36545.1. Frameshift.
    AF493924 mRNA. Translation: AAM12638.1. Frameshift.
    AK299606 mRNA. Translation: BAH13078.1.
    AK300103 mRNA. Translation: BAH13210.1.
    AK302033 mRNA. Translation: BAH13612.1.
    AK313976 mRNA. Translation: BAG36690.1.
    AC011084 Genomic DNA. No translation available.
    CH471064 Genomic DNA. Translation: EAW68487.1.
    BC013106 mRNA. Translation: AAH13106.1.
    CCDSiCCDS44544.1. [P62070-2]
    CCDS53603.1. [P62070-3]
    CCDS7814.1. [P62070-1]
    PIRiB34788. TVHUC2.
    RefSeqiNP_001096139.1. NM_001102669.2. [P62070-2]
    NP_001170785.1. NM_001177314.1. [P62070-3]
    NP_001170786.1. NM_001177315.1. [P62070-2]
    NP_036382.2. NM_012250.5. [P62070-1]
    UniGeneiHs.502004.
    Hs.712835.

    Genome annotation databases

    EnsembliENST00000256196; ENSP00000256196; ENSG00000133818. [P62070-1]
    ENST00000414023; ENSP00000403282; ENSG00000133818. [P62070-2]
    ENST00000526063; ENSP00000434104; ENSG00000133818. [P62070-2]
    ENST00000529237; ENSP00000433230; ENSG00000133818. [P62070-2]
    ENST00000532814; ENSP00000431954; ENSG00000133818. [P62070-2]
    ENST00000534746; ENSP00000437083; ENSG00000133818. [P62070-2]
    ENST00000537760; ENSP00000437547; ENSG00000133818. [P62070-3]
    ENST00000545643; ENSP00000441722; ENSG00000133818. [P62070-4]
    GeneIDi22800.
    KEGGihsa:22800.
    UCSCiuc001mlf.4. human. [P62070-1]
    uc021qed.1. human. [P62070-3]

    Polymorphism databases

    DMDMi49065833.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M31468 mRNA. Translation: AAA36545.1 . Frameshift.
    AF493924 mRNA. Translation: AAM12638.1 . Frameshift.
    AK299606 mRNA. Translation: BAH13078.1 .
    AK300103 mRNA. Translation: BAH13210.1 .
    AK302033 mRNA. Translation: BAH13612.1 .
    AK313976 mRNA. Translation: BAG36690.1 .
    AC011084 Genomic DNA. No translation available.
    CH471064 Genomic DNA. Translation: EAW68487.1 .
    BC013106 mRNA. Translation: AAH13106.1 .
    CCDSi CCDS44544.1. [P62070-2 ]
    CCDS53603.1. [P62070-3 ]
    CCDS7814.1. [P62070-1 ]
    PIRi B34788. TVHUC2.
    RefSeqi NP_001096139.1. NM_001102669.2. [P62070-2 ]
    NP_001170785.1. NM_001177314.1. [P62070-3 ]
    NP_001170786.1. NM_001177315.1. [P62070-2 ]
    NP_036382.2. NM_012250.5. [P62070-1 ]
    UniGenei Hs.502004.
    Hs.712835.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2ERY X-ray 1.70 A/B 12-181 [» ]
    ProteinModelPortali P62070.
    SMRi P62070. Positions 13-181.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 116480. 15 interactions.
    IntActi P62070. 14 interactions.
    MINTi MINT-5001153.
    STRINGi 9606.ENSP00000256196.

    PTM databases

    PhosphoSitei P62070.

    Polymorphism databases

    DMDMi 49065833.

    Proteomic databases

    MaxQBi P62070.
    PaxDbi P62070.
    PeptideAtlasi P62070.
    PRIDEi P62070.

    Protocols and materials databases

    DNASUi 22800.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000256196 ; ENSP00000256196 ; ENSG00000133818 . [P62070-1 ]
    ENST00000414023 ; ENSP00000403282 ; ENSG00000133818 . [P62070-2 ]
    ENST00000526063 ; ENSP00000434104 ; ENSG00000133818 . [P62070-2 ]
    ENST00000529237 ; ENSP00000433230 ; ENSG00000133818 . [P62070-2 ]
    ENST00000532814 ; ENSP00000431954 ; ENSG00000133818 . [P62070-2 ]
    ENST00000534746 ; ENSP00000437083 ; ENSG00000133818 . [P62070-2 ]
    ENST00000537760 ; ENSP00000437547 ; ENSG00000133818 . [P62070-3 ]
    ENST00000545643 ; ENSP00000441722 ; ENSG00000133818 . [P62070-4 ]
    GeneIDi 22800.
    KEGGi hsa:22800.
    UCSCi uc001mlf.4. human. [P62070-1 ]
    uc021qed.1. human. [P62070-3 ]

    Organism-specific databases

    CTDi 22800.
    GeneCardsi GC11M014299.
    HGNCi HGNC:17271. RRAS2.
    HPAi CAB010420.
    MIMi 167000. phenotype.
    600098. gene.
    neXtProti NX_P62070.
    PharmGKBi PA34862.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG1100.
    HOGENOMi HOG000233973.
    HOVERGENi HBG009351.
    InParanoidi P62070.
    KOi K07830.
    OMAi XKFQEQE.
    PhylomeDBi P62070.
    TreeFami TF312796.

    Enzyme and pathway databases

    SignaLinki P62070.

    Miscellaneous databases

    EvolutionaryTracei P62070.
    GeneWikii RRAS2.
    GenomeRNAii 22800.
    NextBioi 43146.
    PROi P62070.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P62070.
    Bgeei P62070.
    CleanExi HS_RRAS2.
    Genevestigatori P62070.

    Family and domain databases

    Gene3Di 3.40.50.300. 1 hit.
    InterProi IPR027417. P-loop_NTPase.
    IPR005225. Small_GTP-bd_dom.
    IPR001806. Small_GTPase.
    IPR020849. Small_GTPase_Ras.
    [Graphical view ]
    PANTHERi PTHR24070. PTHR24070. 1 hit.
    Pfami PF00071. Ras. 1 hit.
    [Graphical view ]
    PRINTSi PR00449. RASTRNSFRMNG.
    SMARTi SM00173. RAS. 1 hit.
    [Graphical view ]
    SUPFAMi SSF52540. SSF52540. 1 hit.
    TIGRFAMsi TIGR00231. small_GTP. 1 hit.
    PROSITEi PS51421. RAS. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Characterization of four novel ras-like genes expressed in a human teratocarcinoma cell line."
      Drivas G.T., Shih A., Coutavas E., Rush M.G., D'Eustachio P.
      Mol. Cell. Biol. 10:1793-1798(1990) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "A human oncogene of the RAS superfamily unmasked by expression cDNA cloning."
      Chan A.M.-L., Miki T., Meyers K.A., Aaronson S.A.
      Proc. Natl. Acad. Sci. U.S.A. 91:7558-7562(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: SEQUENCE REVISION TO 5-11, TISSUE SPECIFICITY, VARIANT OVARIAN CANCER LEU-72.
    3. "cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org)."
      Puhl H.L. III, Ikeda S.R., Aronstam R.S.
      Submitted (MAR-2002) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Heart.
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3 AND 4).
      Tissue: Brain, Pericardium and Uterus.
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Bone.
    8. "A tagging-via-substrate technology for detection and proteomics of farnesylated proteins."
      Kho Y., Kim S.C., Jiang C., Barma D., Kwon S.W., Cheng J., Jaunbergs J., Weinbaum C., Tamanoi F., Falck J., Zhao Y.
      Proc. Natl. Acad. Sci. U.S.A. 101:12479-12484(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: ISOPRENYLATION AT CYS-201.
    9. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
      Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
      Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-186, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    10. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
      Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
      Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-186, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    11. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-186, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    12. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
      Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
      Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].
    13. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-186, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    14. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-186, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    15. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    16. "The crystal structure of the Ras related protein RRAS2 in the GDP bound state."
      Structural genomics consortium (SGC)
      Submitted (FEB-2009) to the PDB data bank
      Cited for: X-RAY CRYSTALLOGRAPHY (1.7 ANGSTROMS) OF 10-181 IN COMPLEX WITH GDP.

    Entry informationi

    Entry nameiRRAS2_HUMAN
    AccessioniPrimary (citable) accession number: P62070
    Secondary accession number(s): B2R9Z3
    , B7Z5Z2, B7Z6C4, B7Z7H6, P17082
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 21, 2004
    Last sequence update: June 21, 2004
    Last modified: October 1, 2014
    This is version 123 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 11
      Human chromosome 11: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3