P62070 (RRAS2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 109.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Ras-related protein R-Ras2 Alternative name(s): Ras-like protein TC21 Teratocarcinoma oncogene | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 204 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | It is a plasma membrane-associated GTP-binding protein with GTPase activity. Might transduce growth inhibitory signals across the cell membrane, exerting its effect through an effector shared with the Ras proteins but in an antagonistic fashion. |
| Subcellular location | Cell membrane; Lipid-anchor; Cytoplasmic side By similarity. Note: Inner surface of plasma membrane possibly with attachment requiring acylation of the C-terminal cysteine (By similarity with RAS). |
| Tissue specificity | Ubiquitously present in all tissues examined, with the highest levels in heart, placenta, and skeletal muscle. Moderate levels in lung and liver; low levels in brain, kidney, and pancreas. Ref.2 |
| Post-translational modification | May be post-translationally modified by both palmitoylation and polyisoprenylation. |
| Involvement in disease | Ovarian cancer (OC) [MIM:167000]: The term ovarian cancer defines malignancies originating from ovarian tissue. Although many histologic types of ovarian tumors have been described, epithelial ovarian carcinoma is the most common form. Ovarian cancers are often asymptomatic and the recognized signs and symptoms, even of late-stage disease, are vague. Consequently, most patients are diagnosed with advanced disease. |
| Sequence similarities | Belongs to the small GTPase superfamily. Ras family. |
| Sequence caution | The sequence AAA36545.1 differs from that shown. Reason: Frameshift at positions 4, 8 and 12. The sequence AAM12638.1 differs from that shown. Reason: Frameshift at positions 4, 8 and 12. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing |
| Disease | Disease mutation Proto-oncogene |
| Ligand | GTP-binding Nucleotide-binding |
| PTM | Lipoprotein Methylation Palmitate Phosphoprotein Prenylation |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | Ras protein signal transduction Inferred from electronic annotation. Source: Compara positive regulation of cell migrationInferred from electronic annotation. Source: Compara |
| Cellular_component | endoplasmic reticulum Non-traceable author statement PubMed 10777492. Source: ProtInc plasma membraneNon-traceable author statement PubMed 10777492. Source: ProtInc |
| Molecular_function | GTP binding Inferred from electronic annotation. Source: UniProtKB-KW GTPase activityTraceable author statement PubMed 10777492. Source: ProtInc |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| ARAF | P10398 | 3 | EBI-491037,EBI-365961 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P62070-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P62070-2) The sequence of this isoform differs from the canonical sequence as follows: 1-77: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: P62070-3) The sequence of this isoform differs from the canonical sequence as follows: 1-36: MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQ → M | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 201 | 201 | Ras-related protein R-Ras2 | PRO_0000082652 | |||||||||||||||||||||||||||||||
| Propeptide | 202 – 204 | 3 | Removed in mature form By similarity | PRO_0000281302 | |||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||
| Nucleotide binding | 21 – 29 | 9 | GTP | ||||||||||||||||||||||||||||||||
| Nucleotide binding | 68 – 72 | 5 | GTP By similarity | ||||||||||||||||||||||||||||||||
| Nucleotide binding | 127 – 130 | 4 | GTP | ||||||||||||||||||||||||||||||||
| Nucleotide binding | 157 – 159 | 3 | GTP | ||||||||||||||||||||||||||||||||
| Motif | 43 – 51 | 9 | Effector region By similarity | ||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||
| Modified residue | 186 | 1 | Phosphoserine Ref.9 Ref.10 Ref.11 Ref.12 Ref.13 | ||||||||||||||||||||||||||||||||
| Modified residue | 201 | 1 | Cysteine methyl ester Probable | ||||||||||||||||||||||||||||||||
| Lipidation | 199 | 1 | S-palmitoyl cysteine Potential | ||||||||||||||||||||||||||||||||
| Lipidation | 201 | 1 | S-farnesyl cysteine Ref.8 | ||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 77 | 77 | Missing in isoform 2. | VSP_043066 | |||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 36 | 36 | MAAAG…IQFIQ → M in isoform 3. | VSP_044485 | |||||||||||||||||||||||||||||||
| Natural variant | 72 | 1 | Q → L in an ovarian cancer sample; somatic mutation. Ref.2 | VAR_006848 | |||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||
| Beta strand | 14 – 21 | 8 | |||||||||||||||||||||||||||||||||
| Helix | 27 – 36 | 10 | |||||||||||||||||||||||||||||||||
| Beta strand | 49 – 57 | 9 | |||||||||||||||||||||||||||||||||
| Beta strand | 60 – 68 | 9 | |||||||||||||||||||||||||||||||||
| Helix | 77 – 85 | 9 | |||||||||||||||||||||||||||||||||
| Beta strand | 87 – 94 | 8 | |||||||||||||||||||||||||||||||||
| Helix | 98 – 102 | 5 | |||||||||||||||||||||||||||||||||
| Helix | 104 – 115 | 12 | |||||||||||||||||||||||||||||||||
| Beta strand | 121 – 127 | 7 | |||||||||||||||||||||||||||||||||
| Helix | 139 – 148 | 10 | |||||||||||||||||||||||||||||||||
| Beta strand | 152 – 155 | 4 | |||||||||||||||||||||||||||||||||
| Turn | 158 – 161 | 4 | |||||||||||||||||||||||||||||||||
| Helix | 164 – 178 | 15 | |||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Characterization of four novel ras-like genes expressed in a human teratocarcinoma cell line." Drivas G.T., Shih A., Coutavas E., Rush M.G., D'Eustachio P. Mol. Cell. Biol. 10:1793-1798(1990) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "A human oncogene of the RAS superfamily unmasked by expression cDNA cloning." Chan A.M.-L., Miki T., Meyers K.A., Aaronson S.A. Proc. Natl. Acad. Sci. U.S.A. 91:7558-7562(1994) [PubMed] [Europe PMC] [Abstract] Cited for: SEQUENCE REVISION TO 5-11, TISSUE SPECIFICITY, VARIANT OVARIAN CANCER LEU-72. |
| [3] | "cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org)." Puhl H.L. III, Ikeda S.R., Aronstam R.S. Submitted (MAR-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Heart. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3). Tissue: Pericardium and Uterus. |
| [5] | "Human chromosome 11 DNA sequence and analysis including novel gene identification." Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. Sakaki Y.Nature 440:497-500(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Bone. |
| [8] | "A tagging-via-substrate technology for detection and proteomics of farnesylated proteins." Kho Y., Kim S.C., Jiang C., Barma D., Kwon S.W., Cheng J., Jaunbergs J., Weinbaum C., Tamanoi F., Falck J., Zhao Y. Proc. Natl. Acad. Sci. U.S.A. 101:12479-12484(2004) [PubMed] [Europe PMC] [Abstract] Cited for: ISOPRENYLATION AT CYS-201. |
| [9] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-186, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [10] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-186, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [11] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-186, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [12] | "Large-scale proteomics analysis of the human kinome." Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H. Mol. Cell. Proteomics 8:1751-1764(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-186, MASS SPECTROMETRY. |
| [13] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-186, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [14] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [15] | "The crystal structure of the Ras related protein RRAS2 in the GDP bound state." Structural genomics consortium (SGC) Submitted (FEB-2009) to the PDB data bank Cited for: X-RAY CRYSTALLOGRAPHY (1.7 ANGSTROMS) OF 10-181 IN COMPLEX WITH GDP. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | M31468 mRNA. Translation: AAA36545.1. Frameshift. AF493924 mRNA. Translation: AAM12638.1. Frameshift. AK300103 mRNA. Translation: BAH13210.1. AK302033 mRNA. Translation: BAH13612.1. AK313976 mRNA. Translation: BAG36690.1. AC011084 Genomic DNA. No translation available. CH471064 Genomic DNA. Translation: EAW68487.1. BC013106 mRNA. Translation: AAH13106.1. | ||||||||||||
| IPI | IPI00856004. IPI00956295. IPI01011983. | ||||||||||||
| PIR | TVHUC2. B34788. | ||||||||||||
| RefSeq | NP_001096139.1. NM_001102669.2. NP_001170785.1. NM_001177314.1. NP_001170786.1. NM_001177315.1. NP_036382.2. NM_012250.5. | ||||||||||||
| UniGene | Hs.502004. Hs.712835. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | P62070. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | P62070. 14 interactions. | ||||||||||||
| MINT | MINT-5001153. | ||||||||||||
| STRING | 9606.ENSP00000256196. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | P62070. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 49065833. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | P62070. | ||||||||||||
| PeptideAtlas | P62070. | ||||||||||||
| PRIDE | P62070. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 22800. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000256196; ENSP00000256196; ENSG00000133818. ENST00000414023; ENSP00000403282; ENSG00000133818. ENST00000526063; ENSP00000434104; ENSG00000133818. ENST00000529237; ENSP00000433230; ENSG00000133818. ENST00000532814; ENSP00000431954; ENSG00000133818. ENST00000534746; ENSP00000437083; ENSG00000133818. ENST00000537760; ENSP00000437547; ENSG00000133818. ENST00000571727; ENSP00000460749; ENSG00000262489. ENST00000572201; ENSP00000460504; ENSG00000262489. ENST00000572397; ENSP00000459423; ENSG00000262489. ENST00000572894; ENSP00000458232; ENSG00000262489. ENST00000573870; ENSP00000458679; ENSG00000262489. ENST00000574530; ENSP00000460998; ENSG00000262489. | ||||||||||||
| GeneID | 22800. | ||||||||||||
| KEGG | hsa:22800. | ||||||||||||
| UCSC | uc001mlf.4. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 22800. | ||||||||||||
| GeneCards | GC11M014299. | ||||||||||||
| HGNC | HGNC:17271. RRAS2. | ||||||||||||
| HPA | CAB010420. | ||||||||||||
| MIM | 167000. phenotype. 600098. gene. | ||||||||||||
| neXtProt | NX_P62070. | ||||||||||||
| PharmGKB | PA34862. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | COG1100. | ||||||||||||
| HOGENOM | HOG000233973. | ||||||||||||
| HOVERGEN | HBG009351. | ||||||||||||
| InParanoid | P62070. | ||||||||||||
| KO | K07830. | ||||||||||||
| OrthoDB | EOG4P5KB6. | ||||||||||||
| PhylomeDB | P62070. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | P62070. | ||||||||||||
| Bgee | P62070. | ||||||||||||
| CleanEx | HS_RRAS2. | ||||||||||||
| Genevestigator | P62070. | ||||||||||||
| GermOnline | ENSG00000133818. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR005225. Small_GTP-bd_dom. IPR001806. Small_GTPase. IPR020849. Small_GTPase_Ras. [Graphical view] | ||||||||||||
| PANTHER | PTHR24070. PTHR24070. 1 hit. | ||||||||||||
| Pfam | PF00071. Ras. 1 hit. [Graphical view] | ||||||||||||
| PRINTS | PR00449. RASTRNSFRMNG. | ||||||||||||
| SMART | SM00173. RAS. 1 hit. [Graphical view] | ||||||||||||
| TIGRFAMs | TIGR00231. small_GTP. 1 hit. | ||||||||||||
| PROSITE | PS51421. RAS. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| EvolutionaryTrace | P62070. | ||||||||||||
| GenomeRNAi | 22800. | ||||||||||||
| NextBio | 43146. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | RRAS2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P62070 Secondary accession number(s): B2R9Z3 P17082 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
