Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ras-related protein R-Ras2

Gene

RRAS2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

It is a plasma membrane-associated GTP-binding protein with GTPase activity. Might transduce growth inhibitory signals across the cell membrane, exerting its effect through an effector shared with the Ras proteins but in an antagonistic fashion.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi21 – 29GTP9
Nucleotide bindingi68 – 72GTPBy similarity5
Nucleotide bindingi127 – 130GTP4
Nucleotide bindingi157 – 159GTP3

GO - Molecular functioni

  • GTPase activity Source: ProtInc
  • GTP binding Source: UniProtKB-KW

GO - Biological processi

  • osteoblast differentiation Source: UniProtKB
  • positive regulation of cell migration Source: Ensembl
  • Ras protein signal transduction Source: Ensembl
  • regulation of neuron death Source: UniProtKB

Keywordsi

LigandGTP-binding, Nucleotide-binding

Enzyme and pathway databases

SignaLinkiP62070
SIGNORiP62070

Names & Taxonomyi

Protein namesi
Recommended name:
Ras-related protein R-Ras2
Alternative name(s):
Ras-like protein TC21
Teratocarcinoma oncogene
Gene namesi
Name:RRAS2
Synonyms:TC21
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

EuPathDBiHostDB:ENSG00000133818.12
HGNCiHGNC:17271 RRAS2
MIMi600098 gene
neXtProtiNX_P62070

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Involvement in diseasei

Ovarian cancer (OC)1 Publication
Disease susceptibility is associated with variations affecting the gene represented in this entry.
Disease descriptionThe term ovarian cancer defines malignancies originating from ovarian tissue. Although many histologic types of ovarian tumors have been described, epithelial ovarian carcinoma is the most common form. Ovarian cancers are often asymptomatic and the recognized signs and symptoms, even of late-stage disease, are vague. Consequently, most patients are diagnosed with advanced disease.
See also OMIM:167000

Keywords - Diseasei

Disease mutation, Proto-oncogene

Organism-specific databases

DisGeNETi22800
MalaCardsiRRAS2
MIMi167000 phenotype
OpenTargetsiENSG00000133818
PharmGKBiPA34862

Polymorphism and mutation databases

BioMutaiRRAS2
DMDMi49065833

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00000826522 – 201Ras-related protein R-Ras2Add BLAST200
PropeptideiPRO_0000281302202 – 204Removed in mature formBy similarity3

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1
Modified residuei186PhosphoserineCombined sources1
Lipidationi199S-palmitoyl cysteineSequence analysis1
Modified residuei201Cysteine methyl esterCurated1
Lipidationi201S-farnesyl cysteine1 Publication1

Post-translational modificationi

May be post-translationally modified by both palmitoylation and polyisoprenylation.

Keywords - PTMi

Acetylation, Lipoprotein, Methylation, Palmitate, Phosphoprotein, Prenylation

Proteomic databases

EPDiP62070
MaxQBiP62070
PaxDbiP62070
PeptideAtlasiP62070
PRIDEiP62070

PTM databases

iPTMnetiP62070
PhosphoSitePlusiP62070
SwissPalmiP62070

Expressioni

Tissue specificityi

Ubiquitously present in all tissues examined, with the highest levels in heart, placenta, and skeletal muscle. Moderate levels in lung and liver; low levels in brain, kidney, and pancreas.1 Publication

Gene expression databases

BgeeiENSG00000133818
CleanExiHS_RRAS2
ExpressionAtlasiP62070 baseline and differential
GenevisibleiP62070 HS

Organism-specific databases

HPAiCAB010420
HPA050942

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
ARAFP103983EBI-491037,EBI-365961

Protein-protein interaction databases

BioGridi116480, 39 interactors
IntActiP62070, 38 interactors
MINTiP62070
STRINGi9606.ENSP00000256196

Structurei

Secondary structure

1204
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi14 – 21Combined sources8
Helixi27 – 36Combined sources10
Beta strandi49 – 57Combined sources9
Beta strandi60 – 68Combined sources9
Helixi77 – 85Combined sources9
Beta strandi87 – 94Combined sources8
Helixi98 – 102Combined sources5
Helixi104 – 115Combined sources12
Beta strandi121 – 127Combined sources7
Helixi139 – 148Combined sources10
Beta strandi152 – 155Combined sources4
Turni158 – 161Combined sources4
Helixi164 – 178Combined sources15

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2ERYX-ray1.70A/B12-181[»]
ProteinModelPortaliP62070
SMRiP62070
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP62070

Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi43 – 51Effector region9

Sequence similaritiesi

Belongs to the small GTPase superfamily. Ras family.Curated

Phylogenomic databases

eggNOGiKOG0395 Eukaryota
COG1100 LUCA
GeneTreeiENSGT00860000133672
HOGENOMiHOG000233973
HOVERGENiHBG009351
InParanoidiP62070
KOiK07830
OMAiYAQTYKL
OrthoDBiEOG091G0UAU
PhylomeDBiP62070
TreeFamiTF312796

Family and domain databases

InterProiView protein in InterPro
IPR027417 P-loop_NTPase
IPR005225 Small_GTP-bd_dom
IPR001806 Small_GTPase
IPR020849 Small_GTPase_Ras-type
PANTHERiPTHR24070 PTHR24070, 1 hit
PfamiView protein in Pfam
PF00071 Ras, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
TIGRFAMsiTIGR00231 small_GTP, 1 hit
PROSITEiView protein in PROSITE
PS51421 RAS, 1 hit

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P62070-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAAGWRDGS GQEKYRLVVV GGGGVGKSAL TIQFIQSYFV TDYDPTIEDS
60 70 80 90 100
YTKQCVIDDR AARLDILDTA GQEEFGAMRE QYMRTGEGFL LVFSVTDRGS
110 120 130 140 150
FEEIYKFQRQ ILRVKDRDEF PMILIGNKAD LDHQRQVTQE EGQQLARQLK
160 170 180 190 200
VTYMEASAKI RMNVDQAFHE LVRVIRKFQE QECPPSPEPT RKEKDKKGCH

CVIF
Length:204
Mass (Da):23,400
Last modified:June 21, 2004 - v1
Checksum:iBA7D4759DC49446F
GO
Isoform 2 (identifier: P62070-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-77: Missing.

Note: No experimental confirmation available.
Show »
Length:127
Mass (Da):15,094
Checksum:i58F3090C7A5F9B60
GO
Isoform 3 (identifier: P62070-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQ → M

Note: No experimental confirmation available.
Show »
Length:169
Mass (Da):19,841
Checksum:iA9C28F683B9E5A63
GO
Isoform 4 (identifier: P62070-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     36-36: Q → QFFLFLQ

Note: No experimental confirmation available.
Show »
Length:210
Mass (Da):24,196
Checksum:i881713C4D54A663E
GO

Sequence cautioni

The sequence AAA36545 differs from that shown. Reason: Frameshift at positions 4, 8 and 12.Curated
The sequence AAM12638 differs from that shown. Reason: Frameshift at positions 4, 8 and 12.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_00684872Q → L in an ovarian cancer sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs113954997Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0430661 – 77Missing in isoform 2. 1 PublicationAdd BLAST77
Alternative sequenceiVSP_0444851 – 36MAAAG…IQFIQ → M in isoform 3. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_05584236Q → QFFLFLQ in isoform 4. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M31468 mRNA Translation: AAA36545.1 Frameshift.
AF493924 mRNA Translation: AAM12638.1 Frameshift.
AK299606 mRNA Translation: BAH13078.1
AK300103 mRNA Translation: BAH13210.1
AK302033 mRNA Translation: BAH13612.1
AK313976 mRNA Translation: BAG36690.1
AC011084 Genomic DNA No translation available.
CH471064 Genomic DNA Translation: EAW68487.1
BC013106 mRNA Translation: AAH13106.1
CCDSiCCDS44544.1 [P62070-2]
CCDS53603.1 [P62070-3]
CCDS7814.1 [P62070-1]
PIRiB34788 TVHUC2
RefSeqiNP_001096139.1, NM_001102669.2 [P62070-2]
NP_001170785.1, NM_001177314.1 [P62070-3]
NP_001170786.1, NM_001177315.1 [P62070-2]
NP_036382.2, NM_012250.5 [P62070-1]
UniGeneiHs.502004
Hs.712835

Genome annotation databases

EnsembliENST00000256196; ENSP00000256196; ENSG00000133818 [P62070-1]
ENST00000414023; ENSP00000403282; ENSG00000133818 [P62070-2]
ENST00000526063; ENSP00000434104; ENSG00000133818 [P62070-2]
ENST00000529237; ENSP00000433230; ENSG00000133818 [P62070-2]
ENST00000532814; ENSP00000431954; ENSG00000133818 [P62070-2]
ENST00000534746; ENSP00000437083; ENSG00000133818 [P62070-2]
ENST00000537760; ENSP00000437547; ENSG00000133818 [P62070-3]
GeneIDi22800
KEGGihsa:22800
UCSCiuc001mlf.5 human [P62070-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiRRAS2_HUMAN
AccessioniPrimary (citable) accession number: P62070
Secondary accession number(s): B2R9Z3
, B7Z5Z2, B7Z6C4, B7Z7H6, P17082
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 21, 2004
Last sequence update: June 21, 2004
Last modified: May 23, 2018
This is version 157 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health