Reviewed, UniProtKB/Swiss-Prot P61966 (AP1S1_HUMAN)

Names and origin

Protein names

Recommended name:
    AP-1 complex subunit sigma-1A
Alternative name(s):
    Adapter-related protein complex 1 sigma-1A subunit
    Adaptor protein complex AP-1 sigma-1A subunit
    Sigma-adaptin 1A
    Sigma1A-adaptin
    Golgi adaptor HA1/AP1 adaptin sigma-1A subunit
    HA1 19 kDa subunit
    Clathrin assembly protein complex 1 sigma-1A small chain
    Clathrin coat assembly protein AP19
    Sigma 1a subunit of AP-1 clathrin

Gene names

Name:	AP1S1
Synonyms:	AP19, CLAPS1

Organism

Homo sapiens (Human) [Complete proteome]

Taxonomic identifier

9606 [NCBI]

Taxonomic lineage

Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo

Protein attributes

Sequence length	158 AA.
Sequence status	Complete.
Sequence processing	The displayed sequence is not processed.
Protein existence	Evidence at protein level.

General annotation (Comments)

Function	Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules. Ref.1
Subunit structure	Adaptor protein complex 1 (AP-1) is an heterotetramer composed of two large adaptins (gamma-type subunit AP1G1 and beta-type subunit AP1B1), a medium adaptin (mu-type subunit AP1M1 or AP1M2) and a small adaptin (sigma-type subunit AP1S1 or AP1S2 or AP1S3).
Subcellular location	Golgi apparatus. Cytoplasmic vesicle membrane; Peripheral membrane protein; Cytoplasmic side. Membrane › clathrin-coated pit. Note: Component of the coat surrounding the cytoplasmic face of coated vesicles located at the Golgi complex. Ref.1
Tissue specificity	Widely expressed. Ref.1
Sequence similarities	Belongs to the adaptor complexes small subunit family.

Ontologies

Keywords
Biological process	Endocytosis Protein transport Transport
Cellular component	Coated pit Cytoplasmic vesicle Golgi apparatus Membrane
Coding sequence diversity	Alternative splicing
PTM	Phosphoprotein
Technical term	Complete proteome
Gene Ontology (GO)
Biological process	intracellular protein transport Inferred from electronic annotation. Source: InterPro post-Golgi vesicle-mediated transport Inferred from Experiment. Source: Reactome receptor-mediated endocytosis Ref.1 Traceable author statement. Source: UniProtKB
Cellular component	AP-1 adaptor complex Ref.1 Traceable author statement. Source: UniProtKB coated pit Inferred from electronic annotation. Source: UniProtKB-SubCell cytosol Inferred from Experiment. Source: Reactome
Molecular function	protein binding Inferred from sequence or structural similarity. Source: UniProtKB protein transporter activity Inferred from electronic annotation. Source: InterPro
Complete GO annotation...

Binary interactions

With	Entry	#Exp.	IntAct	Notes
ARMC6	Q6NXE6	1	EBI-516199,EBI-1053802
GK006	Q6P2I7	1	EBI-516199,EBI-1047027
RAB10	P61026	1	EBI-516199,EBI-726075
SEC61A1	P61619	1	EBI-516199,EBI-358919
SLC16A1	P53985	1	EBI-516199,EBI-1054708

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]

Isoform 1 (identifier: P61966-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

Isoform 2 (identifier: P61966-2)

The sequence of this isoform differs from the canonical sequence as follows:
     128-158: KKSVLKAIEQADLLQEEDESPRSVLEEMGLA → TFPFSH

Sequence annotation (Features)

	Feature key	Position(s)	Length	Description	Graphical view	Feature identifier
Molecule processing
	Chain	1 – 158	158	AP-1 complex subunit sigma-1A		PRO_0000193797
Amino acid modifications
	Modified residue	147	1	Phosphoserine Ref.7
Natural variations
	Alternative sequence	128 – 158	31	KKSVL…EMGLA → TFPFSH in isoform 2.		VSP_000171

Sequences

	Sequence		Length	Mass (Da)
	Isoform 1 [UniParc]. Last modified June 7, 2004. Version 1. Checksum: E461937790406D8B	FASTA	158	18,733
	10 20 30 40 50 60 MMRFMLLFSR QGKLRLQKWY LATSDKERKK MVRELMQVVL ARKPKMCSFL EWRDLKVVYK 70 80 90 100 110 120 RYASLYFCCA IEGQDNELIT LELIHRYVEL LDKYFGSVCE LDIIFNFEKA YFILDEFLMG 130 140 150 GDVQDTSKKS VLKAIEQADL LQEEDESPRS VLEEMGLA
	Isoform 2 [UniParc] [UniParc]. Checksum: 3FB1FD64446EBFD6	FASTA	133	16,011
	10 20 30 40 50 60 MMRFMLLFSR QGKLRLQKWY LATSDKERKK MVRELMQVVL ARKPKMCSFL EWRDLKVVYK 70 80 90 100 110 120 RYASLYFCCA IEGQDNELIT LELIHRYVEL LDKYFGSVCE LDIIFNFEKA YFILDEFLMG 130 GDVQDTSTFP FSH

References

	« Hide 'large scale' referencesShow 'large scale' references »
[1]	"Identification and characterization of novel clathrin adaptor-related proteins." Takatsu H., Sakurai M., Shin H.-W., Murakami K., Nakayama K. J. Biol. Chem. 273:24693-24700(1998) [PubMed: 9733768] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
[2]	"Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
[3]	"Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S. Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Caudate nucleus.
[4]	"The DNA sequence of human chromosome 7." Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K. Nature 424:157-164(2003) [PubMed: 12853948] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]	Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C. Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]	"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Placenta.
[7]	"Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed: 18691976] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-147, MASS SPECTROMETRY.
[8]	Colinge J., Superti-Furga G., Bennett K.L. Submitted (OCT-2008) to UniProtKB Cited for: IDENTIFICATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY.
[9]	"Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501(2009) [PubMed: 19413330] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-147, MASS SPECTROMETRY.
+	Additional computationally mapped references.

Cross-references

Sequence databases
EMBLGenBankDDBJ	AB015319 mRNA. Translation: BAA33391.1. BT006779 mRNA. Translation: AAP35425.1. AK312151 mRNA. Translation: BAG35085.1. AC004876 Genomic DNA. Translation: AAD45829.1. Different initiation. CH471197 Genomic DNA. Translation: EAW50199.1. BC003561 mRNA. Translation: AAH03561.1.
IPI	IPI00100559. IPI00152898.
RefSeq	NP_001274.1.
UniGene	Hs.489365
3D structure databases
ModBase	Search...
Protein-protein interaction databases
IntAct	P61966. 7 interactions.
STRING	P61966.
PTM databases
PhosphoSite	P61966.
Proteomic databases
PRIDE	P61966.
Genome annotation databases
Ensembl	ENST00000337619; ENSP00000336666; ENSG00000106367; Homo sapiens. [Genome view] ENST00000443943; ENSP00000410780; ENSG00000106367; Homo sapiens. [Genome view]
GeneID	1174.
KEGG	hsa:1174.
UCSC	uc003uxv.2. human.
Organism-specific databases
CTD	1174.
GeneCards	GC07P100584.
H-InvDB	HIX0006945.
HGNC	HGNC:559. AP1S1.
MIM	603531. gene.
Orphanet	171851. MEDNIK syndrome.
PharmGKB	PA24850.
GenAtlas	Search...
Phylogenomic databases
HOGENOM	P61966.
HOVERGEN	P61966.
Enzyme and pathway databases
Reactome	REACT_11123. Membrane Trafficking. REACT_6185. HIV Infection.
Gene expression databases
ArrayExpress	P61966.
Bgee	P61966.
CleanEx	HS_AP1S1.
Genevestigator	P61966.
GermOnline	ENSG00000106367. Homo sapiens.
Family and domain databases
InterPro	IPR016635. AP_complex_ssu. IPR015604. Clathrin_AP1_sigma. IPR000804. Clathrin_sigma/coatomer_zeta. IPR011012. Longin-like. [Graphical view]
PANTHER	PTHR11753:SF5. Clathrin_coat_assembly_AP19. 1 hit.
Pfam	PF01217. Clat_adaptor_s. 1 hit. [Graphical view]
PIRSF	PIRSF015588. AP_complex_sigma. 1 hit.
PROSITE	PS00989. CLAT_ADAPTOR_S. 1 hit. [Graphical view]
ProtoNet	Search...
Other Resources
NextBio	4850.
SOURCE	Search...

Entry information

Entry name

AP1S1_HUMAN

Accession

Primary (citable) accession number: P61966
Secondary accession number(s): B2R5D8 , P82267, Q00382, Q53YA7, Q9BTN4, Q9UDW9

Entry history

Integrated into UniProtKB/Swiss-Prot:	June 7, 2004
Last sequence update:	June 7, 2004
Last modified:	November 24, 2009
This is version 58 of the entry and version 1 of the sequence. [Complete history]

Entry status

Reviewed (UniProtKB/Swiss-Prot)

Annotation project

HPI (Human Proteome Initiative)

Disclaimer

Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.