Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Coatomer subunit zeta-1

Gene

COPZ1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. In mammals, the coatomer can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins; the complex also influences the Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors (By similarity).By similarity
The zeta subunit may be involved in regulating the coat assembly and, hence, the rate of biosynthetic protein transport due to its association-dissociation properties with the coatomer complex.

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

ER-Golgi transport, Protein transport, Transport

Enzyme and pathway databases

BioCyciZFISH:ENSG00000111481-MONOMER.
ReactomeiR-HSA-6807878. COPI-mediated anterograde transport.
R-HSA-6811434. COPI-dependent Golgi-to-ER retrograde traffic.

Names & Taxonomyi

Protein namesi
Recommended name:
Coatomer subunit zeta-1
Alternative name(s):
Zeta-1-coat protein
Short name:
Zeta-1 COP
Gene namesi
Name:COPZ1
Synonyms:COPZ
ORF Names:CGI-120, HSPC181
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

HGNCiHGNC:2243. COPZ1.

Subcellular locationi

GO - Cellular componenti

  • COPI vesicle coat Source: UniProtKB
  • cytosol Source: Reactome
  • endoplasmic reticulum membrane Source: Reactome
  • Golgi membrane Source: Reactome
  • transport vesicle Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoplasmic vesicle, Golgi apparatus, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi58 – 59EI → KA: Reduced interaction with gamma subunit. 1 Publication2
Mutagenesisi87 – 88EL → KA: Reduced interaction with gamma subunit. 1 Publication2

Organism-specific databases

OpenTargetsiENSG00000111481.
PharmGKBiPA26760.

Polymorphism and mutation databases

DMDMi48428830.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001938251 – 177Coatomer subunit zeta-1Add BLAST177

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1 Publication1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiP61923.
MaxQBiP61923.
PaxDbiP61923.
PeptideAtlasiP61923.
PRIDEiP61923.
TopDownProteomicsiP61923-1. [P61923-1]

PTM databases

iPTMnetiP61923.
PhosphoSitePlusiP61923.

Expressioni

Gene expression databases

BgeeiENSG00000111481.
CleanExiHS_COPZ1.
ExpressionAtlasiP61923. baseline and differential.
GenevisibleiP61923. HS.

Organism-specific databases

HPAiCAB024984.

Interactioni

Subunit structurei

Oligomeric complex that consists of at least the alpha, beta, beta', gamma, delta, epsilon and zeta subunits.1 Publication

Protein-protein interaction databases

BioGridi116495. 28 interactors.
DIPiDIP-29873N.
IntActiP61923. 5 interactors.
STRINGi9606.ENSP00000262061.

Structurei

Secondary structure

1177
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi14 – 20Combined sources7
Beta strandi25 – 30Combined sources6
Helixi38 – 52Combined sources15
Beta strandi59 – 62Combined sources4
Beta strandi65 – 72Combined sources8
Beta strandi75 – 81Combined sources7
Helixi88 – 105Combined sources18
Helixi111 – 115Combined sources5
Helixi118 – 128Combined sources11
Helixi139 – 148Combined sources10

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2HF6NMR-A1-149[»]
ProteinModelPortaliP61923.
SMRiP61923.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP61923.

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG3343. Eukaryota.
COG5541. LUCA.
GeneTreeiENSGT00390000004405.
HOGENOMiHOG000214428.
HOVERGENiHBG051077.
InParanoidiP61923.
KOiK20472.
PhylomeDBiP61923.
TreeFamiTF300262.

Family and domain databases

InterProiIPR022775. AP_mu_sigma_su.
IPR000804. Clathrin_sm-chain_CS.
IPR011012. Longin-like_dom.
[Graphical view]
PfamiPF01217. Clat_adaptor_s. 1 hit.
[Graphical view]
SUPFAMiSSF64356. SSF64356. 1 hit.
PROSITEiPS00989. CLAT_ADAPTOR_S. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P61923-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEALILEPSL YTVKAILILD NDGDRLFAKY YDDTYPSVKE QKAFEKNIFN
60 70 80 90 100
KTHRTDSEIA LLEGLTVVYK SSIDLYFYVI GSSYENELML MAVLNCLFDS
110 120 130 140 150
LSQMLRKNVE KRALLENMEG LFLAVDEIVD GGVILESDPQ QVVHRVALRG
160 170
EDVPLTEQTV SQVLQSAKEQ IKWSLLR
Length:177
Mass (Da):20,198
Last modified:June 7, 2004 - v1
Checksum:i355530D032D3A049
GO
Isoform 2 (identifier: P61923-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYP → MMEIDFLPSTMTTPTPVSRSKRPLRRTFSTRPIGLT
     37-87: Missing.

Note: No experimental confirmation available.
Show »
Length:126
Mass (Da):14,253
Checksum:i63729DA05B6CAA87
GO
Isoform 3 (identifier: P61923-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     7-29: Missing.

Note: No experimental confirmation available.
Show »
Length:154
Mass (Da):17,624
Checksum:iB72D2F0155584233
GO
Isoform 4 (identifier: P61923-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-6: MEALIL → MGGFRTEGMFVSLQ

Note: No experimental confirmation available. Gene prediction based on EST data.
Show »
Length:185
Mass (Da):21,069
Checksum:i16ABA633D4510033
GO
Isoform 5 (identifier: P61923-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     147-163: Missing.

Note: No experimental confirmation available. Gene prediction based on EST data.
Show »
Length:160
Mass (Da):18,374
Checksum:iF13D7FACABD98416
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0536751 – 36MEALI…DDTYP → MMEIDFLPSTMTTPTPVSRS KRPLRRTFSTRPIGLT in isoform 2. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_0550491 – 6MEALIL → MGGFRTEGMFVSLQ in isoform 4. Curated6
Alternative sequenceiVSP_0550507 – 29Missing in isoform 3. 1 PublicationAdd BLAST23
Alternative sequenceiVSP_05367637 – 87Missing in isoform 2. 1 PublicationAdd BLAST51
Alternative sequenceiVSP_055051147 – 163Missing in isoform 5. CuratedAdd BLAST17

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB047848 mRNA. Translation: BAB17659.1.
AF151878 mRNA. Translation: AAD34115.1.
AF161529 mRNA. Translation: AAF29144.1.
AF086911 mRNA. Translation: AAP97141.1.
AK293377 mRNA. Translation: BAG56889.1.
AK295325 mRNA. Translation: BAG58302.1.
AC078778 Genomic DNA. No translation available.
CH471054 Genomic DNA. Translation: EAW96774.1.
BC002849 mRNA. Translation: AAH02849.1.
CCDSiCCDS61137.1. [P61923-5]
CCDS61138.1. [P61923-3]
CCDS61139.1. [P61923-4]
CCDS8877.1. [P61923-1]
RefSeqiNP_001258663.1. NM_001271734.1. [P61923-3]
NP_001258664.1. NM_001271735.1. [P61923-5]
NP_001258665.1. NM_001271736.1. [P61923-4]
NP_057141.1. NM_016057.2. [P61923-1]
UniGeneiHs.505652.

Genome annotation databases

EnsembliENST00000262061; ENSP00000262061; ENSG00000111481. [P61923-1]
ENST00000455864; ENSP00000410620; ENSG00000111481. [P61923-3]
ENST00000549043; ENSP00000449270; ENSG00000111481. [P61923-4]
ENST00000552362; ENSP00000448444; ENSG00000111481. [P61923-5]
GeneIDi22818.
KEGGihsa:22818.
UCSCiuc001sfs.3. human. [P61923-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB047848 mRNA. Translation: BAB17659.1.
AF151878 mRNA. Translation: AAD34115.1.
AF161529 mRNA. Translation: AAF29144.1.
AF086911 mRNA. Translation: AAP97141.1.
AK293377 mRNA. Translation: BAG56889.1.
AK295325 mRNA. Translation: BAG58302.1.
AC078778 Genomic DNA. No translation available.
CH471054 Genomic DNA. Translation: EAW96774.1.
BC002849 mRNA. Translation: AAH02849.1.
CCDSiCCDS61137.1. [P61923-5]
CCDS61138.1. [P61923-3]
CCDS61139.1. [P61923-4]
CCDS8877.1. [P61923-1]
RefSeqiNP_001258663.1. NM_001271734.1. [P61923-3]
NP_001258664.1. NM_001271735.1. [P61923-5]
NP_001258665.1. NM_001271736.1. [P61923-4]
NP_057141.1. NM_016057.2. [P61923-1]
UniGeneiHs.505652.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2HF6NMR-A1-149[»]
ProteinModelPortaliP61923.
SMRiP61923.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116495. 28 interactors.
DIPiDIP-29873N.
IntActiP61923. 5 interactors.
STRINGi9606.ENSP00000262061.

PTM databases

iPTMnetiP61923.
PhosphoSitePlusiP61923.

Polymorphism and mutation databases

DMDMi48428830.

Proteomic databases

EPDiP61923.
MaxQBiP61923.
PaxDbiP61923.
PeptideAtlasiP61923.
PRIDEiP61923.
TopDownProteomicsiP61923-1. [P61923-1]

Protocols and materials databases

DNASUi22818.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000262061; ENSP00000262061; ENSG00000111481. [P61923-1]
ENST00000455864; ENSP00000410620; ENSG00000111481. [P61923-3]
ENST00000549043; ENSP00000449270; ENSG00000111481. [P61923-4]
ENST00000552362; ENSP00000448444; ENSG00000111481. [P61923-5]
GeneIDi22818.
KEGGihsa:22818.
UCSCiuc001sfs.3. human. [P61923-1]

Organism-specific databases

CTDi22818.
GeneCardsiCOPZ1.
HGNCiHGNC:2243. COPZ1.
HPAiCAB024984.
MIMi615472. gene.
neXtProtiNX_P61923.
OpenTargetsiENSG00000111481.
PharmGKBiPA26760.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3343. Eukaryota.
COG5541. LUCA.
GeneTreeiENSGT00390000004405.
HOGENOMiHOG000214428.
HOVERGENiHBG051077.
InParanoidiP61923.
KOiK20472.
PhylomeDBiP61923.
TreeFamiTF300262.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000111481-MONOMER.
ReactomeiR-HSA-6807878. COPI-mediated anterograde transport.
R-HSA-6811434. COPI-dependent Golgi-to-ER retrograde traffic.

Miscellaneous databases

ChiTaRSiCOPZ1. human.
EvolutionaryTraceiP61923.
GeneWikiiCOPZ1.
GenomeRNAii22818.
PROiP61923.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000111481.
CleanExiHS_COPZ1.
ExpressionAtlasiP61923. baseline and differential.
GenevisibleiP61923. HS.

Family and domain databases

InterProiIPR022775. AP_mu_sigma_su.
IPR000804. Clathrin_sm-chain_CS.
IPR011012. Longin-like_dom.
[Graphical view]
PfamiPF01217. Clat_adaptor_s. 1 hit.
[Graphical view]
SUPFAMiSSF64356. SSF64356. 1 hit.
PROSITEiPS00989. CLAT_ADAPTOR_S. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCOPZ1_HUMAN
AccessioniPrimary (citable) accession number: P61923
Secondary accession number(s): B4DDX8
, B4DHZ0, F8VS17, F8VWL5, Q549N6, Q9Y3C3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 7, 2004
Last sequence update: June 7, 2004
Last modified: November 2, 2016
This is version 120 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.