Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P61923

- COPZ1_HUMAN

UniProt

P61923 - COPZ1_HUMAN

Protein

Coatomer subunit zeta-1

Gene

COPZ1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 101 (01 Oct 2014)
      Sequence version 1 (07 Jun 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. In mammals, the coatomer can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins; the complex also influences the Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors By similarity.By similarity
    The zeta subunit may be involved in regulating the coat assembly and, hence, the rate of biosynthetic protein transport due to its association-dissociation properties with the coatomer complex.

    GO - Biological processi

    1. COPI coating of Golgi vesicle Source: Reactome
    2. intracellular protein transport Source: InterPro
    3. intra-Golgi vesicle-mediated transport Source: UniProtKB
    4. membrane organization Source: Reactome
    5. retrograde vesicle-mediated transport, Golgi to ER Source: UniProtKB

    Keywords - Biological processi

    ER-Golgi transport, Protein transport, Transport

    Enzyme and pathway databases

    ReactomeiREACT_11096. COPI Mediated Transport.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Coatomer subunit zeta-1
    Alternative name(s):
    Zeta-1-coat protein
    Short name:
    Zeta-1 COP
    Gene namesi
    Name:COPZ1
    Synonyms:COPZ
    ORF Names:CGI-120, HSPC181
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 12

    Organism-specific databases

    HGNCiHGNC:2243. COPZ1.

    Subcellular locationi

    Cytoplasm By similarity. Golgi apparatus membrane By similarity; Peripheral membrane protein By similarity; Cytoplasmic side By similarity. Cytoplasmic vesicleCOPI-coated vesicle membrane By similarity; Peripheral membrane protein By similarity; Cytoplasmic side By similarity
    Note: The coatomer is cytoplasmic or polymerized on the cytoplasmic side of the Golgi, as well as on the vesicles/buds originating from it.By similarity

    GO - Cellular componenti

    1. COPI vesicle coat Source: UniProtKB
    2. cytosol Source: Reactome

    Keywords - Cellular componenti

    Cytoplasm, Cytoplasmic vesicle, Golgi apparatus, Membrane

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi58 – 592EI → KA: Reduced interaction with gamma subunit. 1 Publication
    Mutagenesisi87 – 882EL → KA: Reduced interaction with gamma subunit. 1 Publication

    Organism-specific databases

    PharmGKBiPA26760.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 177177Coatomer subunit zeta-1PRO_0000193825Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei1 – 11N-acetylmethionine3 Publications

    Keywords - PTMi

    Acetylation

    Proteomic databases

    MaxQBiP61923.
    PaxDbiP61923.
    PRIDEiP61923.

    PTM databases

    PhosphoSiteiP61923.

    Expressioni

    Gene expression databases

    ArrayExpressiP61923.
    BgeeiP61923.
    CleanExiHS_COPZ1.
    GenevestigatoriP61923.

    Organism-specific databases

    HPAiHPA047727.

    Interactioni

    Subunit structurei

    Oligomeric complex that consists of at least the alpha, beta, beta', gamma, delta, epsilon and zeta subunits.1 Publication

    Protein-protein interaction databases

    BioGridi116495. 20 interactions.
    DIPiDIP-29873N.
    IntActiP61923. 2 interactions.
    STRINGi9606.ENSP00000262061.

    Structurei

    Secondary structure

    1
    177
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi14 – 207
    Beta strandi25 – 306
    Helixi38 – 5215
    Beta strandi59 – 624
    Beta strandi65 – 728
    Beta strandi75 – 817
    Helixi88 – 10518
    Helixi111 – 1155
    Helixi118 – 12811
    Helixi139 – 14810

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2HF6NMR-A1-149[»]
    ProteinModelPortaliP61923.
    SMRiP61923. Positions 1-149.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiP61923.

    Family & Domainsi

    Sequence similaritiesi

    Phylogenomic databases

    eggNOGiCOG5541.
    HOGENOMiHOG000214428.
    HOVERGENiHBG051077.
    InParanoidiP61923.
    PhylomeDBiP61923.
    TreeFamiTF300262.

    Family and domain databases

    InterProiIPR022775. AP_mu_sigma_su.
    IPR000804. Clathrin_sm-chain_CS.
    IPR011012. Longin-like_dom.
    [Graphical view]
    PfamiPF01217. Clat_adaptor_s. 1 hit.
    [Graphical view]
    SUPFAMiSSF64356. SSF64356. 1 hit.
    PROSITEiPS00989. CLAT_ADAPTOR_S. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P61923-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MEALILEPSL YTVKAILILD NDGDRLFAKY YDDTYPSVKE QKAFEKNIFN    50
    KTHRTDSEIA LLEGLTVVYK SSIDLYFYVI GSSYENELML MAVLNCLFDS 100
    LSQMLRKNVE KRALLENMEG LFLAVDEIVD GGVILESDPQ QVVHRVALRG 150
    EDVPLTEQTV SQVLQSAKEQ IKWSLLR 177
    Length:177
    Mass (Da):20,198
    Last modified:June 7, 2004 - v1
    Checksum:i355530D032D3A049
    GO
    Isoform 2 (identifier: P61923-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-36: MEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYP → MMEIDFLPSTMTTPTPVSRSKRPLRRTFSTRPIGLT
         37-87: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:126
    Mass (Da):14,253
    Checksum:i63729DA05B6CAA87
    GO
    Isoform 3 (identifier: P61923-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         7-29: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:154
    Mass (Da):17,624
    Checksum:iB72D2F0155584233
    GO
    Isoform 4 (identifier: P61923-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-6: MEALIL → MGGFRTEGMFVSLQ

    Note: No experimental confirmation available. Gene prediction based on EST data.

    Show »
    Length:185
    Mass (Da):21,069
    Checksum:i16ABA633D4510033
    GO
    Isoform 5 (identifier: P61923-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         147-163: Missing.

    Note: No experimental confirmation available. Gene prediction based on EST data.

    Show »
    Length:160
    Mass (Da):18,374
    Checksum:iF13D7FACABD98416
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 3636MEALI…DDTYP → MMEIDFLPSTMTTPTPVSRS KRPLRRTFSTRPIGLT in isoform 2. 1 PublicationVSP_053675Add
    BLAST
    Alternative sequencei1 – 66MEALIL → MGGFRTEGMFVSLQ in isoform 4. CuratedVSP_055049
    Alternative sequencei7 – 2923Missing in isoform 3. 1 PublicationVSP_055050Add
    BLAST
    Alternative sequencei37 – 8751Missing in isoform 2. 1 PublicationVSP_053676Add
    BLAST
    Alternative sequencei147 – 16317Missing in isoform 5. CuratedVSP_055051Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB047848 mRNA. Translation: BAB17659.1.
    AF151878 mRNA. Translation: AAD34115.1.
    AF161529 mRNA. Translation: AAF29144.1.
    AF086911 mRNA. Translation: AAP97141.1.
    AK293377 mRNA. Translation: BAG56889.1.
    AK295325 mRNA. Translation: BAG58302.1.
    AC078778 Genomic DNA. No translation available.
    CH471054 Genomic DNA. Translation: EAW96774.1.
    BC002849 mRNA. Translation: AAH02849.1.
    CCDSiCCDS61137.1. [P61923-5]
    CCDS61138.1. [P61923-3]
    CCDS61139.1. [P61923-4]
    CCDS8877.1. [P61923-1]
    RefSeqiNP_001258663.1. NM_001271734.1.
    NP_001258664.1. NM_001271735.1.
    NP_001258665.1. NM_001271736.1.
    NP_057141.1. NM_016057.2. [P61923-1]
    UniGeneiHs.505652.

    Genome annotation databases

    EnsembliENST00000262061; ENSP00000262061; ENSG00000111481. [P61923-1]
    ENST00000455864; ENSP00000410620; ENSG00000111481. [P61923-3]
    ENST00000549043; ENSP00000449270; ENSG00000111481. [P61923-4]
    ENST00000552362; ENSP00000448444; ENSG00000111481. [P61923-5]
    GeneIDi22818.
    KEGGihsa:22818.
    UCSCiuc001sfs.2. human. [P61923-1]

    Polymorphism databases

    DMDMi48428830.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB047848 mRNA. Translation: BAB17659.1 .
    AF151878 mRNA. Translation: AAD34115.1 .
    AF161529 mRNA. Translation: AAF29144.1 .
    AF086911 mRNA. Translation: AAP97141.1 .
    AK293377 mRNA. Translation: BAG56889.1 .
    AK295325 mRNA. Translation: BAG58302.1 .
    AC078778 Genomic DNA. No translation available.
    CH471054 Genomic DNA. Translation: EAW96774.1 .
    BC002849 mRNA. Translation: AAH02849.1 .
    CCDSi CCDS61137.1. [P61923-5 ]
    CCDS61138.1. [P61923-3 ]
    CCDS61139.1. [P61923-4 ]
    CCDS8877.1. [P61923-1 ]
    RefSeqi NP_001258663.1. NM_001271734.1.
    NP_001258664.1. NM_001271735.1.
    NP_001258665.1. NM_001271736.1.
    NP_057141.1. NM_016057.2. [P61923-1 ]
    UniGenei Hs.505652.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2HF6 NMR - A 1-149 [» ]
    ProteinModelPortali P61923.
    SMRi P61923. Positions 1-149.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 116495. 20 interactions.
    DIPi DIP-29873N.
    IntActi P61923. 2 interactions.
    STRINGi 9606.ENSP00000262061.

    PTM databases

    PhosphoSitei P61923.

    Polymorphism databases

    DMDMi 48428830.

    Proteomic databases

    MaxQBi P61923.
    PaxDbi P61923.
    PRIDEi P61923.

    Protocols and materials databases

    DNASUi 22818.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000262061 ; ENSP00000262061 ; ENSG00000111481 . [P61923-1 ]
    ENST00000455864 ; ENSP00000410620 ; ENSG00000111481 . [P61923-3 ]
    ENST00000549043 ; ENSP00000449270 ; ENSG00000111481 . [P61923-4 ]
    ENST00000552362 ; ENSP00000448444 ; ENSG00000111481 . [P61923-5 ]
    GeneIDi 22818.
    KEGGi hsa:22818.
    UCSCi uc001sfs.2. human. [P61923-1 ]

    Organism-specific databases

    CTDi 22818.
    GeneCardsi GC12P054718.
    HGNCi HGNC:2243. COPZ1.
    HPAi HPA047727.
    MIMi 615472. gene.
    neXtProti NX_P61923.
    PharmGKBi PA26760.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5541.
    HOGENOMi HOG000214428.
    HOVERGENi HBG051077.
    InParanoidi P61923.
    PhylomeDBi P61923.
    TreeFami TF300262.

    Enzyme and pathway databases

    Reactomei REACT_11096. COPI Mediated Transport.

    Miscellaneous databases

    ChiTaRSi COPZ1. human.
    EvolutionaryTracei P61923.
    GeneWikii COPZ1.
    GenomeRNAii 22818.
    NextBioi 35471054.
    PROi P61923.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P61923.
    Bgeei P61923.
    CleanExi HS_COPZ1.
    Genevestigatori P61923.

    Family and domain databases

    InterProi IPR022775. AP_mu_sigma_su.
    IPR000804. Clathrin_sm-chain_CS.
    IPR011012. Longin-like_dom.
    [Graphical view ]
    Pfami PF01217. Clat_adaptor_s. 1 hit.
    [Graphical view ]
    SUPFAMi SSF64356. SSF64356. 1 hit.
    PROSITEi PS00989. CLAT_ADAPTOR_S. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Identification and characterization of novel isoforms of COP I subunits."
      Futatsumori M., Kasai K., Takatsu H., Shin H.-W., Nakayama K.
      J. Biochem. 128:793-801(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics."
      Lai C.-H., Chou C.-Y., Ch'ang L.-Y., Liu C.-S., Lin W.-C.
      Genome Res. 10:703-713(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    3. "Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells."
      Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X.
      , Gu J., Chen S.-J., Chen Z.
      Genome Res. 10:1546-1560(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Umbilical cord blood.
    4. "Cloning and expression of a new human cDNA homology to B.taurus z-cop mRNA."
      Tu Q., Yu L., Hu P.R., Zhang H.L., Huang J., Zhao S.Y.
      Submitted (JUL-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
      Tissue: Caudate nucleus and Urinary bladder.
    6. "The finished DNA sequence of human chromosome 12."
      Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
      , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
      Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Placenta.
    9. Bienvenut W.V., Zebisch A., Kolch W.
      Submitted (DEC-2008) to UniProtKB
      Cited for: PROTEIN SEQUENCE OF 1-14, ACETYLATION AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY.
      Tissue: Colon carcinoma.
    10. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
      Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
      Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    11. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    12. "Comparative large-scale characterisation of plant vs. mammal proteins reveals similar and idiosyncratic N-alpha acetylation features."
      Bienvenut W.V., Sumpton D., Martinez A., Lilla S., Espagne C., Meinnel T., Giglione C.
      Mol. Cell. Proteomics 11:M111.015131-M111.015131(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    13. "Solution structure of human zeta-COP: direct evidences for structural similarity between COP I and clathrin-adaptor coats."
      Yu W., Lin J., Jin C., Xia B.
      J. Mol. Biol. 386:903-912(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: STRUCTURE BY NMR, SUBUNIT, MUTAGENESIS OF 58-LYS-ILE-59 AND 87-GLU-LEU-88.

    Entry informationi

    Entry nameiCOPZ1_HUMAN
    AccessioniPrimary (citable) accession number: P61923
    Secondary accession number(s): B4DDX8
    , B4DHZ0, F8VS17, F8VWL5, Q549N6, Q9Y3C3
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 7, 2004
    Last sequence update: June 7, 2004
    Last modified: October 1, 2014
    This is version 101 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human chromosome 12
      Human chromosome 12: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3