Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Coatomer subunit zeta-1

Gene

COPZ1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. In mammals, the coatomer can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins; the complex also influences the Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors (By similarity).By similarity
The zeta subunit may be involved in regulating the coat assembly and, hence, the rate of biosynthetic protein transport due to its association-dissociation properties with the coatomer complex.

GO - Biological processi

Keywordsi

Biological processER-Golgi transport, Protein transport, Transport

Enzyme and pathway databases

ReactomeiR-HSA-6807878 COPI-mediated anterograde transport
R-HSA-6811434 COPI-dependent Golgi-to-ER retrograde traffic

Names & Taxonomyi

Protein namesi
Recommended name:
Coatomer subunit zeta-1
Alternative name(s):
Zeta-1-coat protein
Short name:
Zeta-1 COP
Gene namesi
Name:COPZ1
Synonyms:COPZ
ORF Names:CGI-120, HSPC181
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

EuPathDBiHostDB:ENSG00000111481.9
HGNCiHGNC:2243 COPZ1
MIMi615472 gene
neXtProtiNX_P61923

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoplasmic vesicle, Golgi apparatus, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi58 – 59EI → KA: Reduced interaction with gamma subunit. 1 Publication2
Mutagenesisi87 – 88EL → KA: Reduced interaction with gamma subunit. 1 Publication2

Organism-specific databases

DisGeNETi22818
OpenTargetsiENSG00000111481
PharmGKBiPA26760

Polymorphism and mutation databases

DMDMi48428830

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001938251 – 177Coatomer subunit zeta-1Add BLAST177

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1 Publication1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiP61923
MaxQBiP61923
PaxDbiP61923
PeptideAtlasiP61923
PRIDEiP61923
ProteomicsDBi57338
TopDownProteomicsiP61923-1 [P61923-1]

PTM databases

iPTMnetiP61923
PhosphoSitePlusiP61923

Expressioni

Gene expression databases

BgeeiENSG00000111481
CleanExiHS_COPZ1
ExpressionAtlasiP61923 baseline and differential
GenevisibleiP61923 HS

Interactioni

Subunit structurei

Oligomeric complex that consists of at least the alpha, beta, beta', gamma, delta, epsilon and zeta subunits.1 Publication

Protein-protein interaction databases

BioGridi116495, 49 interactors
DIPiDIP-29873N
IntActiP61923, 9 interactors
STRINGi9606.ENSP00000262061

Structurei

Secondary structure

1177
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi15 – 20Combined sources6
Beta strandi25 – 30Combined sources6
Beta strandi32 – 35Combined sources4
Helixi38 – 50Combined sources13
Beta strandi58 – 62Combined sources5
Beta strandi65 – 71Combined sources7
Beta strandi73 – 82Combined sources10
Helixi87 – 104Combined sources18
Turni105 – 107Combined sources3
Helixi111 – 115Combined sources5
Helixi118 – 128Combined sources11
Helixi139 – 149Combined sources11

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2HF6NMR-A1-149[»]
5MC7X-ray1.60A/B7-150[»]
ProteinModelPortaliP61923
SMRiP61923
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP61923

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG3343 Eukaryota
COG5541 LUCA
GeneTreeiENSGT00390000004405
HOGENOMiHOG000214428
HOVERGENiHBG051077
InParanoidiP61923
KOiK20472
PhylomeDBiP61923
TreeFamiTF300262

Family and domain databases

InterProiView protein in InterPro
IPR022775 AP_mu_sigma_su
IPR000804 Clathrin_sm-chain_CS
IPR011012 Longin-like_dom_sf
PfamiView protein in Pfam
PF01217 Clat_adaptor_s, 1 hit
SUPFAMiSSF64356 SSF64356, 1 hit
PROSITEiView protein in PROSITE
PS00989 CLAT_ADAPTOR_S, 1 hit

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P61923-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEALILEPSL YTVKAILILD NDGDRLFAKY YDDTYPSVKE QKAFEKNIFN
60 70 80 90 100
KTHRTDSEIA LLEGLTVVYK SSIDLYFYVI GSSYENELML MAVLNCLFDS
110 120 130 140 150
LSQMLRKNVE KRALLENMEG LFLAVDEIVD GGVILESDPQ QVVHRVALRG
160 170
EDVPLTEQTV SQVLQSAKEQ IKWSLLR
Length:177
Mass (Da):20,198
Last modified:June 7, 2004 - v1
Checksum:i355530D032D3A049
GO
Isoform 2 (identifier: P61923-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYP → MMEIDFLPSTMTTPTPVSRSKRPLRRTFSTRPIGLT
     37-87: Missing.

Note: No experimental confirmation available.
Show »
Length:126
Mass (Da):14,253
Checksum:i63729DA05B6CAA87
GO
Isoform 3 (identifier: P61923-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     7-29: Missing.

Note: No experimental confirmation available.
Show »
Length:154
Mass (Da):17,624
Checksum:iB72D2F0155584233
GO
Isoform 4 (identifier: P61923-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-6: MEALIL → MGGFRTEGMFVSLQ

Note: No experimental confirmation available. Gene prediction based on EST data.
Show »
Length:185
Mass (Da):21,069
Checksum:i16ABA633D4510033
GO
Isoform 5 (identifier: P61923-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     147-163: Missing.

Note: No experimental confirmation available. Gene prediction based on EST data.
Show »
Length:160
Mass (Da):18,374
Checksum:iF13D7FACABD98416
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0536751 – 36MEALI…DDTYP → MMEIDFLPSTMTTPTPVSRS KRPLRRTFSTRPIGLT in isoform 2. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_0550491 – 6MEALIL → MGGFRTEGMFVSLQ in isoform 4. Curated6
Alternative sequenceiVSP_0550507 – 29Missing in isoform 3. 1 PublicationAdd BLAST23
Alternative sequenceiVSP_05367637 – 87Missing in isoform 2. 1 PublicationAdd BLAST51
Alternative sequenceiVSP_055051147 – 163Missing in isoform 5. CuratedAdd BLAST17

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB047848 mRNA Translation: BAB17659.1
AF151878 mRNA Translation: AAD34115.1
AF161529 mRNA Translation: AAF29144.1
AF086911 mRNA Translation: AAP97141.1
AK293377 mRNA Translation: BAG56889.1
AK295325 mRNA Translation: BAG58302.1
AC078778 Genomic DNA No translation available.
CH471054 Genomic DNA Translation: EAW96774.1
BC002849 mRNA Translation: AAH02849.1
CCDSiCCDS61137.1 [P61923-5]
CCDS61138.1 [P61923-3]
CCDS61139.1 [P61923-4]
CCDS8877.1 [P61923-1]
RefSeqiNP_001258663.1, NM_001271734.1 [P61923-3]
NP_001258664.1, NM_001271735.1 [P61923-5]
NP_001258665.1, NM_001271736.1 [P61923-4]
NP_057141.1, NM_016057.2 [P61923-1]
UniGeneiHs.505652

Genome annotation databases

EnsembliENST00000262061; ENSP00000262061; ENSG00000111481 [P61923-1]
ENST00000455864; ENSP00000410620; ENSG00000111481 [P61923-3]
ENST00000549043; ENSP00000449270; ENSG00000111481 [P61923-4]
ENST00000552362; ENSP00000448444; ENSG00000111481 [P61923-5]
GeneIDi22818
KEGGihsa:22818
UCSCiuc001sfs.3 human [P61923-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiCOPZ1_HUMAN
AccessioniPrimary (citable) accession number: P61923
Secondary accession number(s): B4DDX8
, B4DHZ0, F8VS17, F8VWL5, Q549N6, Q9Y3C3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 7, 2004
Last sequence update: June 7, 2004
Last modified: June 20, 2018
This is version 131 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health