Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P61329

- FGF12_MOUSE

UniProt

P61329 - FGF12_MOUSE

Protein

Fibroblast growth factor 12

Gene

Fgf12

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 90 (01 Oct 2014)
      Sequence version 1 (10 May 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Probably involved in nervous system development and function.

    GO - Molecular functioni

    1. heparin binding Source: Ensembl
    2. protein binding Source: MGI
    3. sodium channel regulator activity Source: Ensembl

    GO - Biological processi

    1. adult locomotory behavior Source: MGI
    2. fibroblast growth factor receptor signaling pathway Source: InterPro
    3. JNK cascade Source: Ensembl
    4. negative regulation of cation channel activity Source: Ensembl
    5. neuromuscular process Source: MGI
    6. positive regulation of sodium ion transport Source: MGI
    7. regulation of membrane depolarization Source: Ensembl
    8. regulation of sodium ion transmembrane transporter activity Source: Ensembl
    9. synaptic transmission Source: MGI

    Keywords - Molecular functioni

    Growth factor

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Fibroblast growth factor 12
    Short name:
    FGF-12
    Alternative name(s):
    Fibroblast growth factor homologous factor 1
    Short name:
    FHF-1
    Myocyte-activating factor
    Gene namesi
    Name:Fgf12
    Synonyms:Fhf1
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 16

    Organism-specific databases

    MGIiMGI:109183. Fgf12.

    Subcellular locationi

    Nucleus Curated

    GO - Cellular componenti

    1. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Nucleus

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 243243Fibroblast growth factor 12PRO_0000147605Add
    BLAST

    Proteomic databases

    MaxQBiP61329.
    PaxDbiP61329.
    PRIDEiP61329.

    PTM databases

    PhosphoSiteiP61329.

    Expressioni

    Gene expression databases

    BgeeiP61329.
    CleanExiMM_FGF12.
    GenevestigatoriP61329.

    Interactioni

    Subunit structurei

    Interacts with the C-terminal region of SCN9A.By similarity

    Structurei

    3D structure databases

    ProteinModelPortaliP61329.
    SMRiP61329. Positions 68-205.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi11 – 3828Bipartite nuclear localization signalSequence AnalysisAdd
    BLAST

    Sequence similaritiesi

    Phylogenomic databases

    eggNOGiNOG275698.
    GeneTreeiENSGT00730000110666.
    HOGENOMiHOG000290676.
    HOVERGENiHBG007580.
    InParanoidiP61329.
    KOiK04358.
    OMAiYIGMNGE.
    OrthoDBiEOG7J447D.
    PhylomeDBiP61329.
    TreeFamiTF330751.

    Family and domain databases

    InterProiIPR008996. Cytokine_IL1-like.
    IPR028254. FGF12.
    IPR002209. Fibroblast_GF_fam.
    IPR028142. IL-1_fam/FGF_fam.
    [Graphical view]
    PANTHERiPTHR11486. PTHR11486. 1 hit.
    PTHR11486:SF17. PTHR11486:SF17. 1 hit.
    PfamiPF00167. FGF. 1 hit.
    [Graphical view]
    PRINTSiPR00263. HBGFFGF.
    PR00262. IL1HBGF.
    SMARTiSM00442. FGF. 1 hit.
    [Graphical view]
    SUPFAMiSSF50353. SSF50353. 1 hit.
    PROSITEiPS00247. HBGF_FGF. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P61329-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAAAIASSLI RQKRQARESN SDRVSASKRR SSPSKDGRSL CERHVLGVFS    50
    KVRFCSGRKR PVRRRPEPQL KGIVTRLFSQ QGYFLQMHPD GTIDGTKDEN 100
    SDYTLFNLIP VGLRVVAIQG VKASLYVAMN GEGYLYSSDV FTPECKFKES 150
    VFENYYVIYS STLYRQQESG RAWFLGLNKE GQIMKGNRVK KTKPSSHFVP 200
    KPIEVCMYRE PSLHEIGEKQ GRSRKSSGTP TMNGGKVVNQ DST 243
    Length:243
    Mass (Da):27,399
    Last modified:May 10, 2004 - v1
    Checksum:i773ED10B5BDD033C
    GO
    Isoform 2 (identifier: P61329-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-66: MAAAIASSLIRQKRQARESNSDRVSASKRRSSPSKDGRSLCERHVLGVFSKVRFCSGRKRPVRRRP → MESK

    Show »
    Length:181
    Mass (Da):20,424
    Checksum:iE150D8758875C8B7
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti42 – 421E → D in AAB71607. (PubMed:9232594)Curated
    Sequence conflicti182 – 1821Q → P in AAB71607. (PubMed:9232594)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 6666MAAAI…VRRRP → MESK in isoform 2. 1 PublicationVSP_010223Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U66201 mRNA. Translation: AAB18917.1.
    AF020738 mRNA. Translation: AAB71607.1.
    AK034335 mRNA. Translation: BAC28679.1.
    BC030485 mRNA. Translation: AAH30485.1.
    CCDSiCCDS28092.1. [P61329-1]
    RefSeqiNP_001263348.1. NM_001276419.1.
    NP_034329.1. NM_010199.3. [P61329-2]
    NP_898887.1. NM_183064.4. [P61329-1]
    UniGeneiMm.7996.

    Genome annotation databases

    EnsembliENSMUST00000100024; ENSMUSP00000097601; ENSMUSG00000022523. [P61329-1]
    GeneIDi14167.
    KEGGimmu:14167.
    UCSCiuc007yvr.1. mouse. [P61329-1]
    uc007yvt.1. mouse. [P61329-2]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U66201 mRNA. Translation: AAB18917.1 .
    AF020738 mRNA. Translation: AAB71607.1 .
    AK034335 mRNA. Translation: BAC28679.1 .
    BC030485 mRNA. Translation: AAH30485.1 .
    CCDSi CCDS28092.1. [P61329-1 ]
    RefSeqi NP_001263348.1. NM_001276419.1.
    NP_034329.1. NM_010199.3. [P61329-2 ]
    NP_898887.1. NM_183064.4. [P61329-1 ]
    UniGenei Mm.7996.

    3D structure databases

    ProteinModelPortali P61329.
    SMRi P61329. Positions 68-205.
    ModBasei Search...
    MobiDBi Search...

    PTM databases

    PhosphoSitei P61329.

    Proteomic databases

    MaxQBi P61329.
    PaxDbi P61329.
    PRIDEi P61329.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000100024 ; ENSMUSP00000097601 ; ENSMUSG00000022523 . [P61329-1 ]
    GeneIDi 14167.
    KEGGi mmu:14167.
    UCSCi uc007yvr.1. mouse. [P61329-1 ]
    uc007yvt.1. mouse. [P61329-2 ]

    Organism-specific databases

    CTDi 2257.
    MGIi MGI:109183. Fgf12.

    Phylogenomic databases

    eggNOGi NOG275698.
    GeneTreei ENSGT00730000110666.
    HOGENOMi HOG000290676.
    HOVERGENi HBG007580.
    InParanoidi P61329.
    KOi K04358.
    OMAi YIGMNGE.
    OrthoDBi EOG7J447D.
    PhylomeDBi P61329.
    TreeFami TF330751.

    Miscellaneous databases

    NextBioi 285314.
    PROi P61329.
    SOURCEi Search...

    Gene expression databases

    Bgeei P61329.
    CleanExi MM_FGF12.
    Genevestigatori P61329.

    Family and domain databases

    InterProi IPR008996. Cytokine_IL1-like.
    IPR028254. FGF12.
    IPR002209. Fibroblast_GF_fam.
    IPR028142. IL-1_fam/FGF_fam.
    [Graphical view ]
    PANTHERi PTHR11486. PTHR11486. 1 hit.
    PTHR11486:SF17. PTHR11486:SF17. 1 hit.
    Pfami PF00167. FGF. 1 hit.
    [Graphical view ]
    PRINTSi PR00263. HBGFFGF.
    PR00262. IL1HBGF.
    SMARTi SM00442. FGF. 1 hit.
    [Graphical view ]
    SUPFAMi SSF50353. SSF50353. 1 hit.
    PROSITEi PS00247. HBGF_FGF. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Fibroblast growth factor (FGF) homologous factors: new members of the FGF family implicated in nervous system development."
      Smallwood P.M., Munoz-Sanjuan I., Tong P., Macke J.P., Hendry S.H., Gilbert D.J., Copeland N.G., Jenkins N.A., Nathans J.
      Proc. Natl. Acad. Sci. U.S.A. 93:9850-9857(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Retina.
    2. "Murine FGF-12 and FGF-13: expression in embryonic nervous system, connective tissue and heart."
      Hartung H., Feldman B., Lovec H., Coulier F., Birnbaum D., Goldfarb M.
      Mech. Dev. 64:31-39(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    3. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Strain: C57BL/6J.
      Tissue: Diencephalon.
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Retina.

    Entry informationi

    Entry nameiFGF12_MOUSE
    AccessioniPrimary (citable) accession number: P61329
    Secondary accession number(s): O35339
    , P70376, Q924B4, Q92912, Q93001
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 10, 2004
    Last sequence update: May 10, 2004
    Last modified: October 1, 2014
    This is version 90 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3