Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P61329

- FGF12_MOUSE

UniProt

P61329 - FGF12_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Fibroblast growth factor 12

Gene

Fgf12

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli

Functioni

Probably involved in nervous system development and function.

GO - Molecular functioni

  1. heparin binding Source: Ensembl
  2. sodium channel regulator activity Source: Ensembl

GO - Biological processi

  1. adult locomotory behavior Source: MGI
  2. fibroblast growth factor receptor signaling pathway Source: InterPro
  3. JNK cascade Source: Ensembl
  4. negative regulation of cation channel activity Source: Ensembl
  5. neuromuscular process Source: MGI
  6. positive regulation of sodium ion transport Source: MGI
  7. regulation of membrane depolarization Source: Ensembl
  8. regulation of sodium ion transmembrane transporter activity Source: Ensembl
  9. synaptic transmission Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Growth factor

Names & Taxonomyi

Protein namesi
Recommended name:
Fibroblast growth factor 12
Short name:
FGF-12
Alternative name(s):
Fibroblast growth factor homologous factor 1
Short name:
FHF-1
Myocyte-activating factor
Gene namesi
Name:Fgf12
Synonyms:Fhf1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 16

Organism-specific databases

MGIiMGI:109183. Fgf12.

Subcellular locationi

Nucleus Curated

GO - Cellular componenti

  1. nucleus Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 243243Fibroblast growth factor 12PRO_0000147605Add
BLAST

Proteomic databases

MaxQBiP61329.
PaxDbiP61329.
PRIDEiP61329.

PTM databases

PhosphoSiteiP61329.

Expressioni

Gene expression databases

BgeeiP61329.
CleanExiMM_FGF12.
GenevestigatoriP61329.

Interactioni

Subunit structurei

Interacts with the C-terminal region of SCN9A.By similarity

Structurei

3D structure databases

ProteinModelPortaliP61329.
SMRiP61329. Positions 68-205.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi11 – 3828Bipartite nuclear localization signalSequence AnalysisAdd
BLAST

Sequence similaritiesi

Phylogenomic databases

eggNOGiNOG275698.
GeneTreeiENSGT00760000118859.
HOGENOMiHOG000290676.
HOVERGENiHBG007580.
InParanoidiP61329.
KOiK04358.
OMAiYIGMNGE.
OrthoDBiEOG7J447D.
PhylomeDBiP61329.
TreeFamiTF330751.

Family and domain databases

InterProiIPR008996. Cytokine_IL1-like.
IPR028254. FGF12.
IPR002209. Fibroblast_GF_fam.
IPR028142. IL-1_fam/FGF_fam.
[Graphical view]
PANTHERiPTHR11486. PTHR11486. 1 hit.
PTHR11486:SF17. PTHR11486:SF17. 1 hit.
PRINTSiPR00263. HBGFFGF.
PR00262. IL1HBGF.
SMARTiSM00442. FGF. 1 hit.
[Graphical view]
SUPFAMiSSF50353. SSF50353. 1 hit.
PROSITEiPS00247. HBGF_FGF. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P61329-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAAIASSLI RQKRQARESN SDRVSASKRR SSPSKDGRSL CERHVLGVFS
60 70 80 90 100
KVRFCSGRKR PVRRRPEPQL KGIVTRLFSQ QGYFLQMHPD GTIDGTKDEN
110 120 130 140 150
SDYTLFNLIP VGLRVVAIQG VKASLYVAMN GEGYLYSSDV FTPECKFKES
160 170 180 190 200
VFENYYVIYS STLYRQQESG RAWFLGLNKE GQIMKGNRVK KTKPSSHFVP
210 220 230 240
KPIEVCMYRE PSLHEIGEKQ GRSRKSSGTP TMNGGKVVNQ DST
Length:243
Mass (Da):27,399
Last modified:May 10, 2004 - v1
Checksum:i773ED10B5BDD033C
GO
Isoform 2 (identifier: P61329-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-66: MAAAIASSLIRQKRQARESNSDRVSASKRRSSPSKDGRSLCERHVLGVFSKVRFCSGRKRPVRRRP → MESK

Show »
Length:181
Mass (Da):20,424
Checksum:iE150D8758875C8B7
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti42 – 421E → D in AAB71607. (PubMed:9232594)Curated
Sequence conflicti182 – 1821Q → P in AAB71607. (PubMed:9232594)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6666MAAAI…VRRRP → MESK in isoform 2. 1 PublicationVSP_010223Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U66201 mRNA. Translation: AAB18917.1.
AF020738 mRNA. Translation: AAB71607.1.
AK034335 mRNA. Translation: BAC28679.1.
BC030485 mRNA. Translation: AAH30485.1.
CCDSiCCDS28092.1. [P61329-1]
RefSeqiNP_001263348.1. NM_001276419.1.
NP_034329.1. NM_010199.3. [P61329-2]
NP_898887.1. NM_183064.4. [P61329-1]
UniGeneiMm.7996.

Genome annotation databases

EnsembliENSMUST00000100024; ENSMUSP00000097601; ENSMUSG00000022523. [P61329-1]
GeneIDi14167.
KEGGimmu:14167.
UCSCiuc007yvr.1. mouse. [P61329-1]
uc007yvt.1. mouse. [P61329-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U66201 mRNA. Translation: AAB18917.1 .
AF020738 mRNA. Translation: AAB71607.1 .
AK034335 mRNA. Translation: BAC28679.1 .
BC030485 mRNA. Translation: AAH30485.1 .
CCDSi CCDS28092.1. [P61329-1 ]
RefSeqi NP_001263348.1. NM_001276419.1.
NP_034329.1. NM_010199.3. [P61329-2 ]
NP_898887.1. NM_183064.4. [P61329-1 ]
UniGenei Mm.7996.

3D structure databases

ProteinModelPortali P61329.
SMRi P61329. Positions 68-205.
ModBasei Search...
MobiDBi Search...

PTM databases

PhosphoSitei P61329.

Proteomic databases

MaxQBi P61329.
PaxDbi P61329.
PRIDEi P61329.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000100024 ; ENSMUSP00000097601 ; ENSMUSG00000022523 . [P61329-1 ]
GeneIDi 14167.
KEGGi mmu:14167.
UCSCi uc007yvr.1. mouse. [P61329-1 ]
uc007yvt.1. mouse. [P61329-2 ]

Organism-specific databases

CTDi 2257.
MGIi MGI:109183. Fgf12.

Phylogenomic databases

eggNOGi NOG275698.
GeneTreei ENSGT00760000118859.
HOGENOMi HOG000290676.
HOVERGENi HBG007580.
InParanoidi P61329.
KOi K04358.
OMAi YIGMNGE.
OrthoDBi EOG7J447D.
PhylomeDBi P61329.
TreeFami TF330751.

Miscellaneous databases

NextBioi 285314.
PROi P61329.
SOURCEi Search...

Gene expression databases

Bgeei P61329.
CleanExi MM_FGF12.
Genevestigatori P61329.

Family and domain databases

InterProi IPR008996. Cytokine_IL1-like.
IPR028254. FGF12.
IPR002209. Fibroblast_GF_fam.
IPR028142. IL-1_fam/FGF_fam.
[Graphical view ]
PANTHERi PTHR11486. PTHR11486. 1 hit.
PTHR11486:SF17. PTHR11486:SF17. 1 hit.
PRINTSi PR00263. HBGFFGF.
PR00262. IL1HBGF.
SMARTi SM00442. FGF. 1 hit.
[Graphical view ]
SUPFAMi SSF50353. SSF50353. 1 hit.
PROSITEi PS00247. HBGF_FGF. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Fibroblast growth factor (FGF) homologous factors: new members of the FGF family implicated in nervous system development."
    Smallwood P.M., Munoz-Sanjuan I., Tong P., Macke J.P., Hendry S.H., Gilbert D.J., Copeland N.G., Jenkins N.A., Nathans J.
    Proc. Natl. Acad. Sci. U.S.A. 93:9850-9857(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Retina.
  2. "Murine FGF-12 and FGF-13: expression in embryonic nervous system, connective tissue and heart."
    Hartung H., Feldman B., Lovec H., Coulier F., Birnbaum D., Goldfarb M.
    Mech. Dev. 64:31-39(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  3. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: C57BL/6J.
    Tissue: Diencephalon.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Retina.

Entry informationi

Entry nameiFGF12_MOUSE
AccessioniPrimary (citable) accession number: P61329
Secondary accession number(s): O35339
, P70376, Q924B4, Q92912, Q93001
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 10, 2004
Last sequence update: May 10, 2004
Last modified: October 29, 2014
This is version 91 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3