Reviewed,
UniProtKB/Swiss-Prot P61328 (FGF12_HUMAN)
Last modified
November 3, 2009.
Version 64.
History...
Clusters with 100%,
90%,
50% identity |
Documents (4) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Fibroblast growth factor 12 Short name=FGF-12 Alternative name(s): Fibroblast growth factor homologous factor 1 Short name=FHF-1 Myocyte-activating factor | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 243 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Probably involved in nervous system development and function. |
| Subunit structure | Interacts with the C-terminal region of SCN9A By similarity. |
| Subcellular location | Nucleus Probable. |
| Tissue specificity | Brain, eye and testis; highly expressed in embryonic retina, olfactory epithelium, olfactory bulb, and in a segmental pattern of the body wall; in adult olfactory bulb, less in cerebellum, deep cerebellar nuclei, cortex and multiple midbrain structures. |
| Sequence similarities | Belongs to the heparin-binding growth factors family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing |
| Molecular function | Growth factor |
| Technical term | 3D-structure Complete proteome |
| Gene Ontology (GO) | |
| Biological process | cell-cell signaling Ref.1 Ref.2 Traceable author statement. Source: ProtInc heart development Ref.2Traceable author statement. Source: ProtInc nervous system development Ref.1Traceable author statement. Source: ProtInc signal transduction Ref.1 Ref.2Traceable author statement. Source: ProtInc |
| Cellular component | extracellular space Ref.2 Traceable author statement. Source: ProtInc nucleus Ref.1Inferred from direct assay. Source: MGI |
| Molecular function | growth factor activity Ref.1 Ref.2 Traceable author statement. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P61328-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P61328-2) Also known as: FGF-12B; The sequence of this isoform differs from the canonical sequence as follows: 1-66: MAAAIASSLIRQKRQARESNSDRVSASKRRSSPSKDGRSLCERHVLGVFSKVRFCSGRKRPVRRRP → MESK |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 243 | 243 | Fibroblast growth factor 12 | PRO_0000147604 | ||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||
| Motif | 11 – 38 | 28 | Bipartite nuclear localization signal Potential | |||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 66 | 66 | MAAAI…VRRRP → MESK in isoform 2. | VSP_010222 | ||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 190 | 1 | K → E in AAB18786. Ref.2 | |||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 211 | 1 | P → Q in AAH22524. Ref.4 | |||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 229 – 243 | 15 | TPTMN…NQDST → HHHDGGKL Ref.2 | |||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 73 – 79 | 7 | ||||||||||||||||||||||||||||||||||||||||||
| Turn | 80 – 82 | 3 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 83 – 87 | 5 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 93 – 97 | 5 | ||||||||||||||||||||||||||||||||||||||||||
| Helix | 102 – 104 | 3 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 106 – 112 | 7 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 115 – 120 | 6 | ||||||||||||||||||||||||||||||||||||||||||
| Turn | 121 – 123 | 3 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 126 – 129 | 4 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 135 – 140 | 6 | ||||||||||||||||||||||||||||||||||||||||||
| Helix | 143 – 145 | 3 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 147 – 152 | 6 | ||||||||||||||||||||||||||||||||||||||||||
| Turn | 153 – 155 | 3 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 156 – 165 | 10 | ||||||||||||||||||||||||||||||||||||||||||
| Turn | 167 – 169 | 3 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 172 – 174 | 3 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 181 – 183 | 3 | ||||||||||||||||||||||||||||||||||||||||||
| Helix | 186 – 188 | 3 | ||||||||||||||||||||||||||||||||||||||||||
| Helix | 194 – 196 | 3 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 198 – 202 | 5 | ||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Fibroblast growth factor (FGF) homologous factors: new members of the FGF family implicated in nervous system development." Smallwood P.M., Munoz-Sanjuan I., Tong P., Macke J.P., Hendry S.H., Gilbert D.J., Copeland N.G., Jenkins N.A., Nathans J. Proc. Natl. Acad. Sci. U.S.A. 93:9850-9857(1996) [PubMed: 8790420] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Retina. |
| [2] | "Cloning and characterization of a cDNA encoding a novel fibroblast growth factor preferentially expressed in human heart." Kok L.D.S., Tsui S.K.W., Waye M.M.Y., Liew C.C., Lee C.-Y., Fung K.-P. Biochem. Biophys. Res. Commun. 255:717-721(1999) [PubMed: 10049777] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Tissue: Heart. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Thalamus. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Brain. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| U66197 mRNA. Translation: AAB18913.1. U76381 mRNA. Translation: AAB18786.3. AK312513 mRNA. Translation: BAG35414.1. BC022524 mRNA. Translation: AAH22524.1. | |||||||||||||
| IPI | IPI00024249. IPI00410208. | ||||||||||||
| PIR | JG0184. | ||||||||||||
| RefSeq | NP_004104.3. NP_066360.1. | ||||||||||||
| UniGene | Hs.584758 | ||||||||||||
3D structure databases | |||||||||||||
| |||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| STRING | P61328. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | P61328. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | P61328. | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000264730; ENSP00000264730; ENSG00000114279; Homo sapiens. [Genome view] ENST00000392454; ENSP00000376248; ENSG00000114279; Homo sapiens. [Genome view] ENST00000418610; ENSP00000395517; ENSG00000114279; Homo sapiens. [Genome view] ENST00000430714; ENSP00000410125; ENSG00000114279; Homo sapiens. [Genome view] ENST00000440901; ENSP00000400948; ENSG00000114279; Homo sapiens. [Genome view] ENST00000445105; ENSP00000393686; ENSG00000114279; Homo sapiens. [Genome view] ENST00000448795; ENSP00000412904; ENSG00000114279; Homo sapiens. [Genome view] ENST00000450716; ENSP00000397635; ENSG00000114279; Homo sapiens. [Genome view] ENST00000454309; ENSP00000413496; ENSG00000114279; Homo sapiens. [Genome view] | ||||||||||||
| GeneID | 2257. | ||||||||||||
| KEGG | hsa:2257. | ||||||||||||
| UCSC | uc003fsx.1. human. uc003fsy.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 2257. | ||||||||||||
| GeneCards | GC03M193342. | ||||||||||||
| H-InvDB | HIX0003950. | ||||||||||||
| HGNC | HGNC:3668. FGF12. | ||||||||||||
| MIM | 601513. gene. | ||||||||||||
| PharmGKB | PA28108. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| HOGENOM | P61328. | ||||||||||||
| HOVERGEN | P61328. | ||||||||||||
| OMA | PSLHEIE. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | P61328. | ||||||||||||
| Bgee | P61328. | ||||||||||||
| CleanEx | HS_FGF12. | ||||||||||||
| Genevestigator | P61328. | ||||||||||||
| GermOnline | ENSG00000114279. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR002209. GF_heparin_bd. IPR002348. IL1_HBGF. [Graphical view] | ||||||||||||
| PANTHER | PTHR11486. IL1_HBGF. 1 hit. | ||||||||||||
| Pfam | PF00167. FGF. 1 hit. [Graphical view] | ||||||||||||
| PRINTS | PR00263. HBGFFGF. PR00262. IL1HBGF. | ||||||||||||
| ProDom | PD000831. IL1_HBGF. 1 hit. [Graphical view] [Entries sharing at least one domain] | ||||||||||||
| SMART | SM00442. FGF. 1 hit. [Graphical view] | ||||||||||||
| PROSITE | PS00247. HBGF_FGF. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other Resources | |||||||||||||
| NextBio | 9143. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | FGF12_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P61328 Secondary accession number(s): B2R6B7 Q93001 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


