Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P61328 (FGF12_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 107. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Fibroblast growth factor 12

Short name=FGF-12
Alternative name(s):
Fibroblast growth factor homologous factor 1
Short name=FHF-1
Myocyte-activating factor
Gene names
Name:FGF12
Synonyms:FGF12B, FHF1
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length243 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Probably involved in nervous system development and function.

Subunit structure

Interacts with the C-terminal region of SCN9A By similarity.

Subcellular location

Nucleus Probable.

Tissue specificity

Brain, eye and testis; highly expressed in embryonic retina, olfactory epithelium, olfactory bulb, and in a segmental pattern of the body wall; in adult olfactory bulb, less in cerebellum, deep cerebellar nuclei, cortex and multiple midbrain structures.

Sequence similarities

Belongs to the heparin-binding growth factors family.

Ontologies

Keywords
   Cellular componentNucleus
   Coding sequence diversityAlternative splicing
   Molecular functionGrowth factor
   Technical term3D-structure
Complete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processJNK cascade

Inferred from physical interaction PubMed 12815063. Source: MGI

adult locomotory behavior

Inferred from electronic annotation. Source: Ensembl

cardiac muscle cell action potential involved in contraction

Non-traceable author statement PubMed 12401812. Source: BHF-UCL

cell-cell signaling

Traceable author statement Ref.2Ref.1. Source: ProtInc

fibroblast growth factor receptor signaling pathway

Inferred from electronic annotation. Source: InterPro

heart development

Traceable author statement Ref.2. Source: ProtInc

negative regulation of cation channel activity

Inferred from electronic annotation. Source: Ensembl

nervous system development

Traceable author statement Ref.1. Source: ProtInc

neuromuscular process

Inferred from electronic annotation. Source: Ensembl

positive regulation of sodium ion transport

Inferred from electronic annotation. Source: Ensembl

regulation of membrane depolarization

Inferred from electronic annotation. Source: Ensembl

regulation of sodium ion transmembrane transport

Inferred from sequence or structural similarity PubMed 12401812. Source: BHF-UCL

regulation of sodium ion transmembrane transporter activity

Inferred from sequence or structural similarity PubMed 12401812. Source: BHF-UCL

signal transduction

Traceable author statement Ref.2Ref.1. Source: ProtInc

synaptic transmission

Inferred from electronic annotation. Source: Ensembl

   Cellular_componentextracellular space

Traceable author statement Ref.2. Source: ProtInc

nucleus

Inferred from direct assay Ref.1. Source: MGI

   Molecular_functiongrowth factor activity

Traceable author statement Ref.2Ref.1. Source: ProtInc

heparin binding

Inferred from direct assay PubMed 12815063. Source: MGI

ion channel binding

Inferred from sequence or structural similarity PubMed 12401812. Source: BHF-UCL

sodium channel regulator activity

Inferred from sequence or structural similarity PubMed 12401812. Source: BHF-UCL

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: P61328-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: P61328-2)

Also known as: FGF-12B;

The sequence of this isoform differs from the canonical sequence as follows:
     1-66: MAAAIASSLIRQKRQARESNSDRVSASKRRSSPSKDGRSLCERHVLGVFSKVRFCSGRKRPVRRRP → MESK

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 243243Fibroblast growth factor 12
PRO_0000147604

Regions

Motif11 – 3828Bipartite nuclear localization signal Potential

Natural variations

Alternative sequence1 – 6666MAAAI…VRRRP → MESK in isoform 2.
VSP_010222

Experimental info

Sequence conflict1901K → E in AAB18786. Ref.2
Sequence conflict2111P → Q in AAH22524. Ref.5
Sequence conflict229 – 24315TPTMN…NQDST → HHHDGGKL in AAB18786. Ref.2

Secondary structure

.................................... 243
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified May 10, 2004. Version 1.
Checksum: 773ED10B5BDD033C

FASTA24327,399
        10         20         30         40         50         60 
MAAAIASSLI RQKRQARESN SDRVSASKRR SSPSKDGRSL CERHVLGVFS KVRFCSGRKR 

        70         80         90        100        110        120 
PVRRRPEPQL KGIVTRLFSQ QGYFLQMHPD GTIDGTKDEN SDYTLFNLIP VGLRVVAIQG 

       130        140        150        160        170        180 
VKASLYVAMN GEGYLYSSDV FTPECKFKES VFENYYVIYS STLYRQQESG RAWFLGLNKE 

       190        200        210        220        230        240 
GQIMKGNRVK KTKPSSHFVP KPIEVCMYRE PSLHEIGEKQ GRSRKSSGTP TMNGGKVVNQ 


DST 

« Hide

Isoform 2 (FGF-12B) [UniParc].

Checksum: E150D8758875C8B7
Show »

FASTA18120,424

References

« Hide 'large scale' references
[1]"Fibroblast growth factor (FGF) homologous factors: new members of the FGF family implicated in nervous system development."
Smallwood P.M., Munoz-Sanjuan I., Tong P., Macke J.P., Hendry S.H., Gilbert D.J., Copeland N.G., Jenkins N.A., Nathans J.
Proc. Natl. Acad. Sci. U.S.A. 93:9850-9857(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Retina.
[2]"Cloning and characterization of a cDNA encoding a novel fibroblast growth factor preferentially expressed in human heart."
Kok L.D.S., Tsui S.K.W., Waye M.M.Y., Liew C.C., Lee C.-Y., Fung K.-P.
Biochem. Biophys. Res. Commun. 255:717-721(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
Tissue: Heart.
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Tissue: Hippocampus and Thalamus.
[4]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Brain.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
U66197 mRNA. Translation: AAB18913.1.
U76381 mRNA. Translation: AAB18786.3.
AK125307 mRNA. Translation: BAG54181.1.
AK313671 mRNA. Translation: BAG36423.1.
AK312513 mRNA. Translation: BAG35414.1.
CH471052 Genomic DNA. Translation: EAW78084.1.
BC022524 mRNA. Translation: AAH22524.1.
CCDSCCDS3301.1. [P61328-1]
CCDS46983.1. [P61328-2]
PIRJG0184.
RefSeqNP_004104.3. NM_004113.5. [P61328-2]
NP_066360.1. NM_021032.4. [P61328-1]
UniGeneHs.390250.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
1Q1UX-ray1.70A67-206[»]
4JQ0X-ray3.84A1-243[»]
ProteinModelPortalP61328.
SMRP61328. Positions 68-205.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid108548. 8 interactions.
DIPDIP-59850N.
IntActP61328. 3 interactions.
STRING9606.ENSP00000413496.

PTM databases

PhosphoSiteP61328.

Polymorphism databases

DMDM47117683.

Proteomic databases

PaxDbP61328.
PRIDEP61328.

Protocols and materials databases

DNASU2257.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000264730; ENSP00000264730; ENSG00000114279. [P61328-2]
ENST00000445105; ENSP00000393686; ENSG00000114279. [P61328-2]
ENST00000450716; ENSP00000397635; ENSG00000114279. [P61328-2]
ENST00000454309; ENSP00000413496; ENSG00000114279. [P61328-1]
GeneID2257.
KEGGhsa:2257.
UCSCuc003fsx.3. human. [P61328-1]
uc003fsy.3. human. [P61328-2]

Organism-specific databases

CTD2257.
GeneCardsGC03M191859.
HGNCHGNC:3668. FGF12.
MIM601513. gene.
neXtProtNX_P61328.
PharmGKBPA28108.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG275698.
HOVERGENHBG007580.
InParanoidP61328.
KOK04358.
OMAYIGMNGE.
OrthoDBEOG7J447D.
PhylomeDBP61328.
TreeFamTF330751.

Gene expression databases

ArrayExpressP61328.
BgeeP61328.
CleanExHS_FGF12.
GenevestigatorP61328.

Family and domain databases

InterProIPR008996. Cytokine_IL1-like.
IPR028254. FGF12.
IPR002209. Fibroblast_GF_fam.
IPR028142. IL-1_fam/FGF_fam.
[Graphical view]
PANTHERPTHR11486. PTHR11486. 1 hit.
PTHR11486:SF17. PTHR11486:SF17. 1 hit.
PfamPF00167. FGF. 1 hit.
[Graphical view]
PRINTSPR00263. HBGFFGF.
PR00262. IL1HBGF.
SMARTSM00442. FGF. 1 hit.
[Graphical view]
SUPFAMSSF50353. SSF50353. 1 hit.
PROSITEPS00247. HBGF_FGF. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSFGF12. human.
EvolutionaryTraceP61328.
GeneWikiFGF12.
GenomeRNAi2257.
NextBio9143.
PROP61328.
SOURCESearch...

Entry information

Entry nameFGF12_HUMAN
AccessionPrimary (citable) accession number: P61328
Secondary accession number(s): B2R6B7 expand/collapse secondary AC list , B2R976, O35339, P70376, Q8TBG5, Q92912, Q93001
Entry history
Integrated into UniProtKB/Swiss-Prot: May 10, 2004
Last sequence update: May 10, 2004
Last modified: July 9, 2014
This is version 107 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 3

Human chromosome 3: entries, gene names and cross-references to MIM