Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P61328

- FGF12_HUMAN

UniProt

P61328 - FGF12_HUMAN

Protein

Fibroblast growth factor 12

Gene

FGF12

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 108 (01 Oct 2014)
      Sequence version 1 (10 May 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Probably involved in nervous system development and function.

    GO - Molecular functioni

    1. growth factor activity Source: ProtInc
    2. heparin binding Source: MGI
    3. ion channel binding Source: BHF-UCL
    4. sodium channel regulator activity Source: BHF-UCL

    GO - Biological processi

    1. adult locomotory behavior Source: Ensembl
    2. cardiac muscle cell action potential involved in contraction Source: BHF-UCL
    3. cell-cell signaling Source: ProtInc
    4. fibroblast growth factor receptor signaling pathway Source: InterPro
    5. heart development Source: ProtInc
    6. JNK cascade Source: MGI
    7. negative regulation of cation channel activity Source: Ensembl
    8. nervous system development Source: ProtInc
    9. neuromuscular process Source: Ensembl
    10. positive regulation of sodium ion transport Source: Ensembl
    11. regulation of membrane depolarization Source: Ensembl
    12. regulation of sodium ion transmembrane transport Source: BHF-UCL
    13. regulation of sodium ion transmembrane transporter activity Source: BHF-UCL
    14. signal transduction Source: ProtInc
    15. synaptic transmission Source: Ensembl

    Keywords - Molecular functioni

    Growth factor

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Fibroblast growth factor 12
    Short name:
    FGF-12
    Alternative name(s):
    Fibroblast growth factor homologous factor 1
    Short name:
    FHF-1
    Myocyte-activating factor
    Gene namesi
    Name:FGF12
    Synonyms:FGF12B, FHF1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 3

    Organism-specific databases

    HGNCiHGNC:3668. FGF12.

    Subcellular locationi

    Nucleus Curated

    GO - Cellular componenti

    1. extracellular space Source: ProtInc
    2. nucleus Source: MGI

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA28108.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 243243Fibroblast growth factor 12PRO_0000147604Add
    BLAST

    Proteomic databases

    PaxDbiP61328.
    PRIDEiP61328.

    PTM databases

    PhosphoSiteiP61328.

    Expressioni

    Tissue specificityi

    Brain, eye and testis; highly expressed in embryonic retina, olfactory epithelium, olfactory bulb, and in a segmental pattern of the body wall; in adult olfactory bulb, less in cerebellum, deep cerebellar nuclei, cortex and multiple midbrain structures.

    Gene expression databases

    ArrayExpressiP61328.
    BgeeiP61328.
    CleanExiHS_FGF12.
    GenevestigatoriP61328.

    Interactioni

    Subunit structurei

    Interacts with the C-terminal region of SCN9A.By similarity

    Protein-protein interaction databases

    BioGridi108548. 8 interactions.
    DIPiDIP-59850N.
    IntActiP61328. 3 interactions.
    STRINGi9606.ENSP00000413496.

    Structurei

    Secondary structure

    1
    243
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi73 – 797
    Turni80 – 823
    Beta strandi83 – 875
    Beta strandi93 – 975
    Helixi102 – 1043
    Beta strandi106 – 1127
    Beta strandi115 – 1206
    Turni121 – 1233
    Beta strandi126 – 1294
    Beta strandi135 – 1406
    Helixi143 – 1453
    Beta strandi147 – 1526
    Turni153 – 1553
    Beta strandi156 – 16510
    Turni167 – 1693
    Beta strandi172 – 1743
    Beta strandi181 – 1833
    Helixi186 – 1883
    Helixi194 – 1963
    Beta strandi198 – 2025

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1Q1UX-ray1.70A67-206[»]
    4JQ0X-ray3.84A1-243[»]
    ProteinModelPortaliP61328.
    SMRiP61328. Positions 68-205.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiP61328.

    Family & Domainsi

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi11 – 3828Bipartite nuclear localization signalSequence AnalysisAdd
    BLAST

    Sequence similaritiesi

    Phylogenomic databases

    eggNOGiNOG275698.
    HOVERGENiHBG007580.
    InParanoidiP61328.
    KOiK04358.
    OMAiYIGMNGE.
    OrthoDBiEOG7J447D.
    PhylomeDBiP61328.
    TreeFamiTF330751.

    Family and domain databases

    InterProiIPR008996. Cytokine_IL1-like.
    IPR028254. FGF12.
    IPR002209. Fibroblast_GF_fam.
    IPR028142. IL-1_fam/FGF_fam.
    [Graphical view]
    PANTHERiPTHR11486. PTHR11486. 1 hit.
    PTHR11486:SF17. PTHR11486:SF17. 1 hit.
    PfamiPF00167. FGF. 1 hit.
    [Graphical view]
    PRINTSiPR00263. HBGFFGF.
    PR00262. IL1HBGF.
    SMARTiSM00442. FGF. 1 hit.
    [Graphical view]
    SUPFAMiSSF50353. SSF50353. 1 hit.
    PROSITEiPS00247. HBGF_FGF. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P61328-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAAAIASSLI RQKRQARESN SDRVSASKRR SSPSKDGRSL CERHVLGVFS    50
    KVRFCSGRKR PVRRRPEPQL KGIVTRLFSQ QGYFLQMHPD GTIDGTKDEN 100
    SDYTLFNLIP VGLRVVAIQG VKASLYVAMN GEGYLYSSDV FTPECKFKES 150
    VFENYYVIYS STLYRQQESG RAWFLGLNKE GQIMKGNRVK KTKPSSHFVP 200
    KPIEVCMYRE PSLHEIGEKQ GRSRKSSGTP TMNGGKVVNQ DST 243
    Length:243
    Mass (Da):27,399
    Last modified:May 10, 2004 - v1
    Checksum:i773ED10B5BDD033C
    GO
    Isoform 2 (identifier: P61328-2) [UniParc]FASTAAdd to Basket

    Also known as: FGF-12B

    The sequence of this isoform differs from the canonical sequence as follows:
         1-66: MAAAIASSLIRQKRQARESNSDRVSASKRRSSPSKDGRSLCERHVLGVFSKVRFCSGRKRPVRRRP → MESK

    Show »
    Length:181
    Mass (Da):20,424
    Checksum:iE150D8758875C8B7
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti190 – 1901K → E in AAB18786. (PubMed:10049777)Curated
    Sequence conflicti211 – 2111P → Q in AAH22524. (PubMed:15489334)Curated
    Sequence conflicti229 – 24315TPTMN…NQDST → HHHDGGKL in AAB18786. (PubMed:10049777)CuratedAdd
    BLAST

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 6666MAAAI…VRRRP → MESK in isoform 2. 3 PublicationsVSP_010222Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U66197 mRNA. Translation: AAB18913.1.
    U76381 mRNA. Translation: AAB18786.3.
    AK125307 mRNA. Translation: BAG54181.1.
    AK313671 mRNA. Translation: BAG36423.1.
    AK312513 mRNA. Translation: BAG35414.1.
    CH471052 Genomic DNA. Translation: EAW78084.1.
    BC022524 mRNA. Translation: AAH22524.1.
    CCDSiCCDS3301.1. [P61328-1]
    CCDS46983.1. [P61328-2]
    PIRiJG0184.
    RefSeqiNP_004104.3. NM_004113.5. [P61328-2]
    NP_066360.1. NM_021032.4. [P61328-1]
    UniGeneiHs.390250.

    Genome annotation databases

    EnsembliENST00000445105; ENSP00000393686; ENSG00000114279. [P61328-2]
    ENST00000450716; ENSP00000397635; ENSG00000114279. [P61328-2]
    ENST00000454309; ENSP00000413496; ENSG00000114279. [P61328-1]
    GeneIDi2257.
    KEGGihsa:2257.
    UCSCiuc003fsx.3. human. [P61328-1]
    uc003fsy.3. human. [P61328-2]

    Polymorphism databases

    DMDMi47117683.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U66197 mRNA. Translation: AAB18913.1 .
    U76381 mRNA. Translation: AAB18786.3 .
    AK125307 mRNA. Translation: BAG54181.1 .
    AK313671 mRNA. Translation: BAG36423.1 .
    AK312513 mRNA. Translation: BAG35414.1 .
    CH471052 Genomic DNA. Translation: EAW78084.1 .
    BC022524 mRNA. Translation: AAH22524.1 .
    CCDSi CCDS3301.1. [P61328-1 ]
    CCDS46983.1. [P61328-2 ]
    PIRi JG0184.
    RefSeqi NP_004104.3. NM_004113.5. [P61328-2 ]
    NP_066360.1. NM_021032.4. [P61328-1 ]
    UniGenei Hs.390250.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1Q1U X-ray 1.70 A 67-206 [» ]
    4JQ0 X-ray 3.84 A 1-243 [» ]
    ProteinModelPortali P61328.
    SMRi P61328. Positions 68-205.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 108548. 8 interactions.
    DIPi DIP-59850N.
    IntActi P61328. 3 interactions.
    STRINGi 9606.ENSP00000413496.

    PTM databases

    PhosphoSitei P61328.

    Polymorphism databases

    DMDMi 47117683.

    Proteomic databases

    PaxDbi P61328.
    PRIDEi P61328.

    Protocols and materials databases

    DNASUi 2257.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000445105 ; ENSP00000393686 ; ENSG00000114279 . [P61328-2 ]
    ENST00000450716 ; ENSP00000397635 ; ENSG00000114279 . [P61328-2 ]
    ENST00000454309 ; ENSP00000413496 ; ENSG00000114279 . [P61328-1 ]
    GeneIDi 2257.
    KEGGi hsa:2257.
    UCSCi uc003fsx.3. human. [P61328-1 ]
    uc003fsy.3. human. [P61328-2 ]

    Organism-specific databases

    CTDi 2257.
    GeneCardsi GC03M191859.
    HGNCi HGNC:3668. FGF12.
    MIMi 601513. gene.
    neXtProti NX_P61328.
    PharmGKBi PA28108.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG275698.
    HOVERGENi HBG007580.
    InParanoidi P61328.
    KOi K04358.
    OMAi YIGMNGE.
    OrthoDBi EOG7J447D.
    PhylomeDBi P61328.
    TreeFami TF330751.

    Miscellaneous databases

    ChiTaRSi FGF12. human.
    EvolutionaryTracei P61328.
    GeneWikii FGF12.
    GenomeRNAii 2257.
    NextBioi 9143.
    PROi P61328.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P61328.
    Bgeei P61328.
    CleanExi HS_FGF12.
    Genevestigatori P61328.

    Family and domain databases

    InterProi IPR008996. Cytokine_IL1-like.
    IPR028254. FGF12.
    IPR002209. Fibroblast_GF_fam.
    IPR028142. IL-1_fam/FGF_fam.
    [Graphical view ]
    PANTHERi PTHR11486. PTHR11486. 1 hit.
    PTHR11486:SF17. PTHR11486:SF17. 1 hit.
    Pfami PF00167. FGF. 1 hit.
    [Graphical view ]
    PRINTSi PR00263. HBGFFGF.
    PR00262. IL1HBGF.
    SMARTi SM00442. FGF. 1 hit.
    [Graphical view ]
    SUPFAMi SSF50353. SSF50353. 1 hit.
    PROSITEi PS00247. HBGF_FGF. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Fibroblast growth factor (FGF) homologous factors: new members of the FGF family implicated in nervous system development."
      Smallwood P.M., Munoz-Sanjuan I., Tong P., Macke J.P., Hendry S.H., Gilbert D.J., Copeland N.G., Jenkins N.A., Nathans J.
      Proc. Natl. Acad. Sci. U.S.A. 93:9850-9857(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Retina.
    2. "Cloning and characterization of a cDNA encoding a novel fibroblast growth factor preferentially expressed in human heart."
      Kok L.D.S., Tsui S.K.W., Waye M.M.Y., Liew C.C., Lee C.-Y., Fung K.-P.
      Biochem. Biophys. Res. Commun. 255:717-721(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
      Tissue: Heart.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Hippocampus and Thalamus.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Brain.

    Entry informationi

    Entry nameiFGF12_HUMAN
    AccessioniPrimary (citable) accession number: P61328
    Secondary accession number(s): B2R6B7
    , B2R976, O35339, P70376, Q8TBG5, Q92912, Q93001
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 10, 2004
    Last sequence update: May 10, 2004
    Last modified: October 1, 2014
    This is version 108 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 3
      Human chromosome 3: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3