SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P61328

- FGF12_HUMAN

UniProt

P61328 - FGF12_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Fibroblast growth factor 12

Gene
FGF12, FGF12B, FHF1
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Probably involved in nervous system development and function.

GO - Molecular functioni

  1. growth factor activity Source: ProtInc
  2. heparin binding Source: MGI
  3. ion channel binding Source: BHF-UCL
  4. sodium channel regulator activity Source: BHF-UCL

GO - Biological processi

  1. adult locomotory behavior Source: Ensembl
  2. cardiac muscle cell action potential involved in contraction Source: BHF-UCL
  3. cell-cell signaling Source: ProtInc
  4. fibroblast growth factor receptor signaling pathway Source: InterPro
  5. heart development Source: ProtInc
  6. JNK cascade Source: MGI
  7. negative regulation of cation channel activity Source: Ensembl
  8. nervous system development Source: ProtInc
  9. neuromuscular process Source: Ensembl
  10. positive regulation of sodium ion transport Source: Ensembl
  11. regulation of membrane depolarization Source: Ensembl
  12. regulation of sodium ion transmembrane transport Source: BHF-UCL
  13. regulation of sodium ion transmembrane transporter activity Source: BHF-UCL
  14. signal transduction Source: ProtInc
  15. synaptic transmission Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Growth factor

Names & Taxonomyi

Protein namesi
Recommended name:
Fibroblast growth factor 12
Short name:
FGF-12
Alternative name(s):
Fibroblast growth factor homologous factor 1
Short name:
FHF-1
Myocyte-activating factor
Gene namesi
Name:FGF12
Synonyms:FGF12B, FHF1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 3

Organism-specific databases

HGNCiHGNC:3668. FGF12.

Subcellular locationi

Nucleus Inferred

GO - Cellular componenti

  1. extracellular space Source: ProtInc
  2. nucleus Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA28108.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 243243Fibroblast growth factor 12PRO_0000147604Add
BLAST

Proteomic databases

PaxDbiP61328.
PRIDEiP61328.

PTM databases

PhosphoSiteiP61328.

Expressioni

Tissue specificityi

Brain, eye and testis; highly expressed in embryonic retina, olfactory epithelium, olfactory bulb, and in a segmental pattern of the body wall; in adult olfactory bulb, less in cerebellum, deep cerebellar nuclei, cortex and multiple midbrain structures.

Gene expression databases

ArrayExpressiP61328.
BgeeiP61328.
CleanExiHS_FGF12.
GenevestigatoriP61328.

Interactioni

Subunit structurei

Interacts with the C-terminal region of SCN9A By similarity.

Protein-protein interaction databases

BioGridi108548. 8 interactions.
DIPiDIP-59850N.
IntActiP61328. 3 interactions.
STRINGi9606.ENSP00000413496.

Structurei

Secondary structure

1
243
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi73 – 797
Turni80 – 823
Beta strandi83 – 875
Beta strandi93 – 975
Helixi102 – 1043
Beta strandi106 – 1127
Beta strandi115 – 1206
Turni121 – 1233
Beta strandi126 – 1294
Beta strandi135 – 1406
Helixi143 – 1453
Beta strandi147 – 1526
Turni153 – 1553
Beta strandi156 – 16510
Turni167 – 1693
Beta strandi172 – 1743
Beta strandi181 – 1833
Helixi186 – 1883
Helixi194 – 1963
Beta strandi198 – 2025

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1Q1UX-ray1.70A67-206[»]
4JQ0X-ray3.84A1-243[»]
ProteinModelPortaliP61328.
SMRiP61328. Positions 68-205.

Miscellaneous databases

EvolutionaryTraceiP61328.

Family & Domainsi

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi11 – 3828Bipartite nuclear localization signal Reviewed predictionAdd
BLAST

Sequence similaritiesi

Phylogenomic databases

eggNOGiNOG275698.
HOVERGENiHBG007580.
InParanoidiP61328.
KOiK04358.
OMAiYIGMNGE.
OrthoDBiEOG7J447D.
PhylomeDBiP61328.
TreeFamiTF330751.

Family and domain databases

InterProiIPR008996. Cytokine_IL1-like.
IPR028254. FGF12.
IPR002209. Fibroblast_GF_fam.
IPR028142. IL-1_fam/FGF_fam.
[Graphical view]
PANTHERiPTHR11486. PTHR11486. 1 hit.
PTHR11486:SF17. PTHR11486:SF17. 1 hit.
PfamiPF00167. FGF. 1 hit.
[Graphical view]
PRINTSiPR00263. HBGFFGF.
PR00262. IL1HBGF.
SMARTiSM00442. FGF. 1 hit.
[Graphical view]
SUPFAMiSSF50353. SSF50353. 1 hit.
PROSITEiPS00247. HBGF_FGF. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P61328-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAAAIASSLI RQKRQARESN SDRVSASKRR SSPSKDGRSL CERHVLGVFS    50
KVRFCSGRKR PVRRRPEPQL KGIVTRLFSQ QGYFLQMHPD GTIDGTKDEN 100
SDYTLFNLIP VGLRVVAIQG VKASLYVAMN GEGYLYSSDV FTPECKFKES 150
VFENYYVIYS STLYRQQESG RAWFLGLNKE GQIMKGNRVK KTKPSSHFVP 200
KPIEVCMYRE PSLHEIGEKQ GRSRKSSGTP TMNGGKVVNQ DST 243
Length:243
Mass (Da):27,399
Last modified:May 10, 2004 - v1
Checksum:i773ED10B5BDD033C
GO
Isoform 2 (identifier: P61328-2) [UniParc]FASTAAdd to Basket

Also known as: FGF-12B

The sequence of this isoform differs from the canonical sequence as follows:
     1-66: MAAAIASSLIRQKRQARESNSDRVSASKRRSSPSKDGRSLCERHVLGVFSKVRFCSGRKRPVRRRP → MESK

Show »
Length:181
Mass (Da):20,424
Checksum:iE150D8758875C8B7
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6666MAAAI…VRRRP → MESK in isoform 2. VSP_010222Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti190 – 1901K → E in AAB18786. 1 Publication
Sequence conflicti211 – 2111P → Q in AAH22524. 1 Publication
Sequence conflicti229 – 24315TPTMN…NQDST → HHHDGGKL in AAB18786. 1 PublicationAdd
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U66197 mRNA. Translation: AAB18913.1.
U76381 mRNA. Translation: AAB18786.3.
AK125307 mRNA. Translation: BAG54181.1.
AK313671 mRNA. Translation: BAG36423.1.
AK312513 mRNA. Translation: BAG35414.1.
CH471052 Genomic DNA. Translation: EAW78084.1.
BC022524 mRNA. Translation: AAH22524.1.
CCDSiCCDS3301.1. [P61328-1]
CCDS46983.1. [P61328-2]
PIRiJG0184.
RefSeqiNP_004104.3. NM_004113.5. [P61328-2]
NP_066360.1. NM_021032.4. [P61328-1]
UniGeneiHs.390250.

Genome annotation databases

EnsembliENST00000264730; ENSP00000264730; ENSG00000114279. [P61328-2]
ENST00000445105; ENSP00000393686; ENSG00000114279. [P61328-2]
ENST00000450716; ENSP00000397635; ENSG00000114279. [P61328-2]
ENST00000454309; ENSP00000413496; ENSG00000114279. [P61328-1]
GeneIDi2257.
KEGGihsa:2257.
UCSCiuc003fsx.3. human. [P61328-1]
uc003fsy.3. human. [P61328-2]

Polymorphism databases

DMDMi47117683.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U66197 mRNA. Translation: AAB18913.1 .
U76381 mRNA. Translation: AAB18786.3 .
AK125307 mRNA. Translation: BAG54181.1 .
AK313671 mRNA. Translation: BAG36423.1 .
AK312513 mRNA. Translation: BAG35414.1 .
CH471052 Genomic DNA. Translation: EAW78084.1 .
BC022524 mRNA. Translation: AAH22524.1 .
CCDSi CCDS3301.1. [P61328-1 ]
CCDS46983.1. [P61328-2 ]
PIRi JG0184.
RefSeqi NP_004104.3. NM_004113.5. [P61328-2 ]
NP_066360.1. NM_021032.4. [P61328-1 ]
UniGenei Hs.390250.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1Q1U X-ray 1.70 A 67-206 [» ]
4JQ0 X-ray 3.84 A 1-243 [» ]
ProteinModelPortali P61328.
SMRi P61328. Positions 68-205.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 108548. 8 interactions.
DIPi DIP-59850N.
IntActi P61328. 3 interactions.
STRINGi 9606.ENSP00000413496.

PTM databases

PhosphoSitei P61328.

Polymorphism databases

DMDMi 47117683.

Proteomic databases

PaxDbi P61328.
PRIDEi P61328.

Protocols and materials databases

DNASUi 2257.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000264730 ; ENSP00000264730 ; ENSG00000114279 . [P61328-2 ]
ENST00000445105 ; ENSP00000393686 ; ENSG00000114279 . [P61328-2 ]
ENST00000450716 ; ENSP00000397635 ; ENSG00000114279 . [P61328-2 ]
ENST00000454309 ; ENSP00000413496 ; ENSG00000114279 . [P61328-1 ]
GeneIDi 2257.
KEGGi hsa:2257.
UCSCi uc003fsx.3. human. [P61328-1 ]
uc003fsy.3. human. [P61328-2 ]

Organism-specific databases

CTDi 2257.
GeneCardsi GC03M191859.
HGNCi HGNC:3668. FGF12.
MIMi 601513. gene.
neXtProti NX_P61328.
PharmGKBi PA28108.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG275698.
HOVERGENi HBG007580.
InParanoidi P61328.
KOi K04358.
OMAi YIGMNGE.
OrthoDBi EOG7J447D.
PhylomeDBi P61328.
TreeFami TF330751.

Miscellaneous databases

ChiTaRSi FGF12. human.
EvolutionaryTracei P61328.
GeneWikii FGF12.
GenomeRNAii 2257.
NextBioi 9143.
PROi P61328.
SOURCEi Search...

Gene expression databases

ArrayExpressi P61328.
Bgeei P61328.
CleanExi HS_FGF12.
Genevestigatori P61328.

Family and domain databases

InterProi IPR008996. Cytokine_IL1-like.
IPR028254. FGF12.
IPR002209. Fibroblast_GF_fam.
IPR028142. IL-1_fam/FGF_fam.
[Graphical view ]
PANTHERi PTHR11486. PTHR11486. 1 hit.
PTHR11486:SF17. PTHR11486:SF17. 1 hit.
Pfami PF00167. FGF. 1 hit.
[Graphical view ]
PRINTSi PR00263. HBGFFGF.
PR00262. IL1HBGF.
SMARTi SM00442. FGF. 1 hit.
[Graphical view ]
SUPFAMi SSF50353. SSF50353. 1 hit.
PROSITEi PS00247. HBGF_FGF. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Fibroblast growth factor (FGF) homologous factors: new members of the FGF family implicated in nervous system development."
    Smallwood P.M., Munoz-Sanjuan I., Tong P., Macke J.P., Hendry S.H., Gilbert D.J., Copeland N.G., Jenkins N.A., Nathans J.
    Proc. Natl. Acad. Sci. U.S.A. 93:9850-9857(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Retina.
  2. "Cloning and characterization of a cDNA encoding a novel fibroblast growth factor preferentially expressed in human heart."
    Kok L.D.S., Tsui S.K.W., Waye M.M.Y., Liew C.C., Lee C.-Y., Fung K.-P.
    Biochem. Biophys. Res. Commun. 255:717-721(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Tissue: Heart.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Hippocampus and Thalamus.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain.

Entry informationi

Entry nameiFGF12_HUMAN
AccessioniPrimary (citable) accession number: P61328
Secondary accession number(s): B2R6B7
, B2R976, O35339, P70376, Q8TBG5, Q92912, Q93001
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 10, 2004
Last sequence update: May 10, 2004
Last modified: July 9, 2014
This is version 107 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi