P61244 (MAX_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 116.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Protein max Alternative name(s): Class D basic helix-loop-helix protein 4 Short name=bHLHd4 Myc-associated factor X | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 160 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Transcription regulator. Forms a sequence-specific DNA-binding protein complex with MYC or MAD which recognizes the core sequence 5'-CAC[GA]TG-3'. The MYC-MAX complex is a transcriptional activator, whereas the MAD-MAX complex is a repressor. May repress transcription via the recruitment of a chromatin remodeling complex containing H3 'Lys-9' histone methyltransferase activity. |
| Subunit structure | Efficient DNA binding requires dimerization with another bHLH protein. Binds DNA as a heterodimer with MYC or MAD. Part of the E2F6.com-1 complex in G0 phase composed of E2F6, MGA, MAX, TFDP1, CBX3, BAT8, EUHMTASE1, RING1, RNF2, MBLR, L3MBTL2 and YAF2. Component of some MLL1/MLL complex, at least composed of the core components MLL, ASH2L, HCFC1/HCF1, WDR5 and RBBP5, as well as the facultative components BAP18, CHD8, E2F6, HSP70, INO80C, KANSL1, LAS1L, MAX, MCRS1, MGA, KAT8/MOF, PELP1, PHF20, PRP31, RING2, RUVB1/TIP49A, RUVB2/TIP49B, SENP3, TAF1, TAF4, TAF6, TAF7, TAF9 and TEX10. Interacts with SPAG9. Ref.8 Ref.10 |
| Subcellular location | |
| Tissue specificity | High levels found in the brain, heart and lung while lower levels are seen in the liver, kidney and skeletal muscle. |
| Post-translational modification | Reversible lysine acetylation might regulate the nuclear-cytoplasmic shuttling of specific Max complexes. |
| Sequence similarities | Belongs to the MAX family. Contains 1 bHLH (basic helix-loop-helix) domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| EPAS1 | Q99814 | 2 | EBI-751711,EBI-447470 | |
| FTH1 | P02794 | 2 | EBI-751711,EBI-713259 | |
| GABBR1 | Q9UBS5 | 3 | EBI-751711,EBI-724156 | |
| MAD1L1 | Q9Y6D9 | 2 | EBI-751711,EBI-742610 | |
| MYC | P01106 | 21 | EBI-751711,EBI-447544 |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform 1 (identifier: P61244-1) Also known as: Long; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P61244-2) Also known as: Short; The sequence of this isoform differs from the canonical sequence as follows: 13-21: Missing. | ||||||
| Note: Contains a phosphoserine at position 2. Initiator Met-1 is removed. Contains a N-acetylserine at position 2. Contains a phosphoserine at position 11. | ||||||
| Isoform 3 (identifier: P61244-3) Also known as: Delta-Max; The sequence of this isoform differs from the canonical sequence as follows: 99-160: VRALEKARSSAQLQTNYPSSDNSLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS → GESES | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 4 (identifier: P61244-4) The sequence of this isoform differs from the canonical sequence as follows: 99-160: VRALEKARSS...SRKKLRMEAS → GEHPSSWGSW...VRASHGVCAQ | ||||||
| Isoform 5 (identifier: P61244-5) The sequence of this isoform differs from the canonical sequence as follows: 58-160: ASRAQILDKA...SRKKLRMEAS → LYFLFWKLCT...QVHKKKECKI | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||
Molecule processing | |||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed Ref.15 | ||||||||||||
| Chain | 2 – 160 | 159 | Protein max | PRO_0000127269 | |||||||||||
Regions | |||||||||||||||
| Domain | 23 – 74 | 52 | bHLH | ||||||||||||
| Region | 81 – 102 | 22 | Leucine-zipper | ||||||||||||
| Motif | 152 – 156 | 5 | Nuclear localization signal | ||||||||||||
Amino acid modifications | |||||||||||||||
| Modified residue | 2 | 1 | N-acetylserine Ref.15 Ref.17 | ||||||||||||
| Modified residue | 2 | 1 | Phosphoserine Ref.12 Ref.14 Ref.15 Ref.17 | ||||||||||||
| Modified residue | 11 | 1 | Phosphoserine Ref.12 Ref.15 Ref.17 | ||||||||||||
| Modified residue | 66 | 1 | N6-acetyllysine Probable | ||||||||||||
| Modified residue | 153 | 1 | N6-acetyllysine; alternate Ref.13 | ||||||||||||
| Modified residue | 154 | 1 | N6-acetyllysine; alternate Ref.13 | ||||||||||||
Natural variations | |||||||||||||||
| Alternative sequence | 13 – 21 | 9 | Missing in isoform 2. | VSP_002117 | |||||||||||
| Alternative sequence | 58 – 160 | 103 | ASRAQ…RMEAS → LYFLFWKLCTPVLHRQSLMQ KCHTFISSYQVHKKKECKI in isoform 5. | VSP_043430 | |||||||||||
| Alternative sequence | 99 – 160 | 62 | VRALE…RMEAS → GESES in isoform 3. | VSP_002118 | |||||||||||
| Alternative sequence | 99 – 160 | 62 | VRALE…RMEAS → GEHPSSWGSWPCCAPARSGF GTWACRVRASHGVCAQ in isoform 4. | VSP_043183 | |||||||||||
Experimental info | |||||||||||||||
| Mutagenesis | 66 | 1 | K → Q: Kept nuclear localization. Loss of nuclear localization; when associated with Q-153 and Q-154. Ref.13 | ||||||||||||
| Mutagenesis | 66 | 1 | K → R: Loss of acetylation, kept nuclear localization; when associated with R-153 and R-154. Ref.13 | ||||||||||||
| Mutagenesis | 153 | 1 | K → Q: Loss of nuclear localization; when associated with Q-66 and Q-154. Kept nuclear localization; when associated with Q-154. Ref.13 | ||||||||||||
| Mutagenesis | 153 | 1 | K → R: Loss of acetylation, kept nuclear localization; when associated with R-66 and R-154. Ref.13 | ||||||||||||
| Mutagenesis | 154 | 1 | K → Q: Loss of nuclear localization; when associated with Q-66 and Q-153. Kept nuclear localization; when associated with Q-153. Ref.13 | ||||||||||||
| Mutagenesis | 154 | 1 | K → R: Loss of acetylation, kept nuclear localization; when associated with R-66 and R-153. Ref.13 | ||||||||||||
Secondary structure | |||||||||||||||
Helix Strand Turn | |||||||||||||||
| Helix | 24 – 47 | 24 | |||||||||||||
| Helix | 51 – 53 | 3 | |||||||||||||
| Helix | 60 – 100 | 41 | |||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Max: a helix-loop-helix zipper protein that forms a sequence-specific DNA-binding complex with Myc." Blackwood E.M., Eisenman R.N. Science 251:1211-1217(1991) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). |
| [2] | "Alternative mRNA forms and open reading frames of the max gene." Vaestrik I., Koskinen P.J., Alitalo R., Maekelae T.P. Oncogene 8:503-507(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [3] | "Alternative forms of Max as enhancers or suppressors of Myc-ras cotransformation." Maekelae T.P., Koskinen P.J., Vaestrik I., Alitalo K. Science 256:373-377(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3). |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3 AND 4). Tissue: Mammary gland, Thalamus and Thymus. |
| [5] | "The DNA sequence and analysis of human chromosome 14." Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H. Weissenbach J.Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 5). Tissue: Brain, Lung and Uterus. |
| [8] | "A complex with chromatin modifiers that occupies E2F- and Myc-responsive genes in G0 cells." Ogawa H., Ishiguro K., Gaubatz S., Livingston D.M., Nakatani Y. Science 296:1132-1136(2002) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION IN COMPLEX WITH E2F6; TFDP1; MGA; EUHMTASE1; BAT8; CBX3; RING1; RNF2; MBLR; L3MBTL2 AND YAF2. |
| [9] | "An unappreciated role for RNA surveillance." Hillman R.T., Green R.E., Brenner S.E. Genome Biol. 5:R8.1-R8.16(2004) [PubMed] [Europe PMC] [Abstract] Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S). |
| [10] | "Physical association and coordinate function of the H3 K4 methyltransferase MLL1 and the H4 K16 acetyltransferase MOF." Dou Y., Milne T.A., Tackett A.J., Smith E.R., Fukuda A., Wysocka J., Allis C.D., Chait B.T., Hess J.L., Roeder R.G. Cell 121:873-885(2005) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION IN THE MLL1/MLL COMPLEX. |
| [11] | "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells." Rush J., Moritz A., Lee K.A., Guo A., Goss V.L., Spek E.J., Zhang H., Zha X.-M., Polakiewicz R.D., Comb M.J. Nat. Biotechnol. 23:94-101(2005) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [12] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-2 AND SER-11, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [13] | "Max is acetylated by p300 at several nuclear localization residues." Faiola F., Wu Y.-T., Pan S., Zhang K., Farina A., Martinez E. Biochem. J. 403:397-407(2007) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION AT LYS-66; LYS-153 AND LYS-154, MUTAGENESIS OF LYS-66; LYS-153 AND LYS-154. |
| [14] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-2 (ISOFORM 2), MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [15] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT SER-2, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-2 AND SER-11, MASS SPECTROMETRY, CLEAVAGE OF INITIATOR METHIONINE. Tissue: Cervix carcinoma. |
| [16] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [17] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT SER-2, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-2 AND SER-11, MASS SPECTROMETRY. |
| [18] | "Recognition by Max of its cognate DNA through a dimeric b/HLH/Z domain." Ferre-D'Amare A.R., Prendergast G.C., Ziff E.B., Burley S.K. Nature 363:38-45(1993) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.9 ANGSTROMS) OF 22-107. |
| [19] | "The crystal structure of an intact human Max-DNA complex: new insights into mechanisms of transcriptional control." Brownlie P., Ceska T., Lamers M., Romier C., Stier G., Teo H., Suck D. Structure 5:509-520(1997) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.8 ANGSTROMS). |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | M64240 mRNA. Translation: AAA36200.1. M64240 mRNA. Translation: AAA36201.1. X66867 Genomic DNA. Translation: CAA47337.1. X66867 Genomic DNA. Translation: CAA47338.1. X66867 Genomic DNA. Translation: CAA47339.1. X60287 mRNA. Translation: CAA42827.1. AK290130 mRNA. Translation: BAF82819.1. AK290929 mRNA. Translation: BAF83618.1. AK292189 mRNA. Translation: BAF84878.1. AK292630 mRNA. Translation: BAF85319.1. AL139022 Genomic DNA. No translation available. CH471061 Genomic DNA. Translation: EAW80899.1. CH471061 Genomic DNA. Translation: EAW80901.1. CH471061 Genomic DNA. Translation: EAW80903.1. CH471061 Genomic DNA. Translation: EAW80904.1. BC003525 mRNA. Translation: AAH03525.1. BC004516 mRNA. Translation: AAH04516.1. BC013669 mRNA. Translation: AAH13669.1. BC027924 mRNA. Translation: AAH27924.1. | ||||||||||||||||||||||||||||||||||||
| IPI | IPI00018214. IPI00060723. IPI00157813. IPI00158128. IPI00219929. | ||||||||||||||||||||||||||||||||||||
| PIR | A38431. A42611. B38431. S33118. | ||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001257997.1. NM_001271068.1. NP_002373.3. NM_002382.4. NP_660087.1. NM_145112.2. NP_660088.1. NM_145113.2. NP_660089.1. NM_145114.2. NP_932061.1. NM_197957.3. | ||||||||||||||||||||||||||||||||||||
| UniGene | Hs.285354. | ||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | P61244. | ||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||
| DIP | DIP-28145N. | ||||||||||||||||||||||||||||||||||||
| IntAct | P61244. 43 interactions. | ||||||||||||||||||||||||||||||||||||
| MINT | MINT-1468374. | ||||||||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000351490. | ||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||
| PhosphoSite | P61244. | ||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||
| DMDM | 47117704. | ||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||
| PaxDb | P61244. | ||||||||||||||||||||||||||||||||||||
| PRIDE | P61244. | ||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||
| DNASU | 4149. | ||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000246163; ENSP00000246163; ENSG00000125952. ENST00000284165; ENSP00000284165; ENSG00000125952. ENST00000358402; ENSP00000351175; ENSG00000125952. ENST00000358664; ENSP00000351490; ENSG00000125952. ENST00000394606; ENSP00000378104; ENSG00000125952. ENST00000553928; ENSP00000451907; ENSG00000125952. ENST00000556979; ENSP00000452378; ENSG00000125952. | ||||||||||||||||||||||||||||||||||||
| GeneID | 4149. | ||||||||||||||||||||||||||||||||||||
| KEGG | hsa:4149. | ||||||||||||||||||||||||||||||||||||
| UCSC | uc001xie.1. human. uc001xif.1. human. uc001xig.1. human. uc001xij.1. human. uc001xik.3. human. | ||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||
| CTD | 4149. | ||||||||||||||||||||||||||||||||||||
| GeneCards | GC14M065472. | ||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:6913. MAX. | ||||||||||||||||||||||||||||||||||||
| HPA | CAB000328. HPA003474. | ||||||||||||||||||||||||||||||||||||
| MIM | 154950. gene. | ||||||||||||||||||||||||||||||||||||
| neXtProt | NX_P61244. | ||||||||||||||||||||||||||||||||||||
| Orphanet | 29072. Hereditary pheochromocytoma-paraganglioma. | ||||||||||||||||||||||||||||||||||||
| PharmGKB | PA30656. | ||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||
| eggNOG | NOG239807. | ||||||||||||||||||||||||||||||||||||
| HOGENOM | HOG000293257. | ||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG008542. | ||||||||||||||||||||||||||||||||||||
| InParanoid | P61244. | ||||||||||||||||||||||||||||||||||||
| KO | K04453. | ||||||||||||||||||||||||||||||||||||
| OMA | ANYSSSD. | ||||||||||||||||||||||||||||||||||||
| PhylomeDB | P61244. | ||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | smad2_3nuclearpathway. Regulation of nuclear SMAD2/3 signaling. telomerasepathway. Regulation of Telomerase. hdac_classi_pathway. Signaling events mediated by HDAC Class I. | ||||||||||||||||||||||||||||||||||||
| SignaLink | P61244. | ||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||
| ArrayExpress | P61244. | ||||||||||||||||||||||||||||||||||||
| Bgee | P61244. | ||||||||||||||||||||||||||||||||||||
| CleanEx | HS_MAX. | ||||||||||||||||||||||||||||||||||||
| Genevestigator | P61244. | ||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000125952. Homo sapiens. | ||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||
| Gene3D | 4.10.280.10. 1 hit. | ||||||||||||||||||||||||||||||||||||
| InterPro | IPR011598. bHLH_dom. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| Pfam | PF00010. HLH. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| SMART | SM00353. HLH. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF47459. HLH_basic. 1 hit. | ||||||||||||||||||||||||||||||||||||
| PROSITE | PS50888. BHLH. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||
| BindingDB | P61244. | ||||||||||||||||||||||||||||||||||||
| ChEMBL | CHEMBL1250363. | ||||||||||||||||||||||||||||||||||||
| ChiTaRS | MAX. human. | ||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | P61244. | ||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 4149. | ||||||||||||||||||||||||||||||||||||
| NextBio | 16302. | ||||||||||||||||||||||||||||||||||||
| PMAP-CutDB | P61244. | ||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | MAX_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P61244 Secondary accession number(s): A8K265 Q96CY8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 14 Human chromosome 14: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
