Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein max

Gene

MAX

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Transcription regulator. Forms a sequence-specific DNA-binding protein complex with MYC or MAD which recognizes the core sequence 5'-CAC[GA]TG-3'. The MYC:MAX complex is a transcriptional activator, whereas the MAD:MAX complex is a repressor. May repress transcription via the recruitment of a chromatin remodeling complex containing H3 'Lys-9' histone methyltransferase activity.

GO - Molecular functioni

  • sequence-specific DNA binding Source: Ensembl
  • transcription coactivator activity Source: ProtInc
  • transcription cofactor activity Source: ProtInc
  • transcription factor activity, sequence-specific DNA binding Source: ProtInc

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Activator, Repressor

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000125952-MONOMER.
ReactomeiR-HSA-69202. Cyclin E associated events during G1/S transition.
R-HSA-69656. Cyclin A:Cdk2-associated events at S phase entry.
SignaLinkiP61244.
SIGNORiP61244.

Names & Taxonomyi

Protein namesi
Recommended name:
Protein max
Alternative name(s):
Class D basic helix-loop-helix protein 4
Short name:
bHLHd4
Myc-associated factor X
Gene namesi
Name:MAX
Synonyms:BHLHD4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 14

Organism-specific databases

HGNCiHGNC:6913. MAX.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: HPA
  • dendrite Source: UniProtKB-SubCell
  • MLL1 complex Source: UniProtKB
  • nucleoplasm Source: HPA
  • nucleus Source: BHF-UCL
  • PML body Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cell projection, Nucleus

Pathology & Biotechi

Involvement in diseasei

Pheochromocytoma (PCC)
Disease susceptibility is associated with variations affecting the gene represented in this entry.
Disease descriptionA catecholamine-producing tumor of chromaffin tissue of the adrenal medulla or sympathetic paraganglia. The cardinal symptom, reflecting the increased secretion of epinephrine and norepinephrine, is hypertension, which may be persistent or intermittent.
See also OMIM:171300

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi66K → Q: Kept nuclear localization. Loss of nuclear localization; when associated with Q-153 and Q-154. 1 Publication1
Mutagenesisi66K → R: Loss of acetylation, kept nuclear localization; when associated with R-153 and R-154. 1 Publication1
Mutagenesisi153K → Q: Loss of nuclear localization; when associated with Q-66 and Q-154. Kept nuclear localization; when associated with Q-154. 1 Publication1
Mutagenesisi153K → R: Loss of acetylation, kept nuclear localization; when associated with R-66 and R-154. 1 Publication1
Mutagenesisi154K → Q: Loss of nuclear localization; when associated with Q-66 and Q-153. Kept nuclear localization; when associated with Q-153. 1 Publication1
Mutagenesisi154K → R: Loss of acetylation, kept nuclear localization; when associated with R-66 and R-153. 1 Publication1

Organism-specific databases

DisGeNETi4149.
MalaCardsiMAX.
MIMi171300. phenotype.
OpenTargetsiENSG00000125952.
Orphaneti29072. Hereditary pheochromocytoma-paraganglioma.
PharmGKBiPA30656.

Chemistry databases

ChEMBLiCHEMBL1250363.

Polymorphism and mutation databases

DMDMi47117704.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00001272692 – 160Protein maxAdd BLAST159
Isoform 2 (identifier: P61244-2)
Initiator methionineiRemovedCombined sources

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylserineCombined sources1
Modified residuei2PhosphoserineCombined sources1
Modified residuei11PhosphoserineCombined sources1
Modified residuei66N6-acetyllysine1 Publication1
Modified residuei107PhosphoserineCombined sources1
Modified residuei153N6-acetyllysine1 Publication1
Modified residuei154N6-acetyllysine1 Publication1
Isoform 2 (identifier: P61244-2)
Modified residuei2PhosphoserineCombined sources1
Modified residuei2N-acetylserineCombined sources1
Modified residuei11PhosphoserineCombined sources1

Post-translational modificationi

Reversible lysine acetylation might regulate the nuclear-cytoplasmic shuttling of specific Max complexes.1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiP61244.
MaxQBiP61244.
PaxDbiP61244.
PeptideAtlasiP61244.
PRIDEiP61244.

PTM databases

iPTMnetiP61244.
PhosphoSitePlusiP61244.

Miscellaneous databases

PMAP-CutDBP61244.

Expressioni

Tissue specificityi

High levels found in the brain, heart and lung while lower levels are seen in the liver, kidney and skeletal muscle.

Gene expression databases

BgeeiENSG00000125952.
CleanExiHS_MAX.
ExpressionAtlasiP61244. baseline and differential.
GenevisibleiP61244. HS.

Organism-specific databases

HPAiCAB000328.
HPA003474.

Interactioni

Subunit structurei

Efficient DNA binding requires dimerization with another bHLH protein. Binds DNA as a heterodimer with MYC or MAD. Part of the E2F6.com-1 complex in G0 phase composed of E2F6, MGA, MAX, TFDP1, CBX3, BAT8, EUHMTASE1, RING1, RNF2, MBLR, L3MBTL2 and YAF2. Component of some MLL1/MLL complex, at least composed of the core components KMT2A/MLL1, ASH2L, HCFC1/HCF1, WDR5 and RBBP5, as well as the facultative components BAP18, CHD8, E2F6, HSP70, INO80C, KANSL1, LAS1L, MAX, MCRS1, MGA, MYST1/MOF, PELP1, PHF20, PRP31, RING2, RUVB1/TIP49A, RUVB2/TIP49B, SENP3, TAF1, TAF4, TAF6, TAF7, TAF9 and TEX10. Interacts with SPAG9. The heterodimer MYC:MAX interacts with ABI1; the interaction may enhance MYC:MAX transcriptional activity.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
BANPQ8N9N53EBI-751711,EBI-744695
E2F6O754614EBI-751711,EBI-749694
EEF1DP296922EBI-751711,EBI-358607
EPAS1Q998142EBI-751711,EBI-447470
FOXK2Q011674EBI-751711,EBI-2509991
FTH1P027942EBI-751711,EBI-713259
GABBR1Q9UBS53EBI-751711,EBI-724156
H2AFYO753672EBI-751711,EBI-2868511
L3MBTL2Q969R55EBI-751711,EBI-739909
LIG3P499162EBI-751711,EBI-1753381
MECP2P516082EBI-751711,EBI-1189067
MGAQ8IWI94EBI-751711,EBI-2815196
MXD1Q051953EBI-751711,EBI-8833637
MXI1P505396EBI-751711,EBI-752241
MYCP0110629EBI-751711,EBI-447544
MYCNP041985EBI-751711,EBI-878369
TFAP2AP055492EBI-751711,EBI-347351
TFDP1Q141864EBI-751711,EBI-749713
UNC45AQ9H3U13EBI-10218525,EBI-1048763
VRK3Q8IV632EBI-751711,EBI-1058605
XRCC1P188872EBI-751711,EBI-947466

Protein-protein interaction databases

BioGridi110319. 99 interactors.
DIPiDIP-28145N.
IntActiP61244. 98 interactors.
MINTiMINT-1468374.
STRINGi9606.ENSP00000351490.

Chemistry databases

BindingDBiP61244.

Structurei

Secondary structure

1160
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi24 – 47Combined sources24
Helixi51 – 53Combined sources3
Helixi60 – 100Combined sources41

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1AN2X-ray2.90A22-107[»]
1HLOX-ray2.80A/B20-92[»]
1NKPX-ray1.80B/E23-102[»]
1NLWX-ray2.00B/E24-99[»]
1R05NMR-A/B22-103[»]
DisProtiDP00084.
ProteinModelPortaliP61244.
SMRiP61244.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP61244.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini23 – 74bHLHPROSITE-ProRule annotationAdd BLAST52

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni81 – 102Leucine-zipperAdd BLAST22

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi152 – 156Nuclear localization signal5

Sequence similaritiesi

Belongs to the MAX family.Curated
Contains 1 bHLH (basic helix-loop-helix) domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG2483. Eukaryota.
ENOG4111V1C. LUCA.
GeneTreeiENSGT00530000064011.
HOGENOMiHOG000293257.
HOVERGENiHBG008542.
InParanoidiP61244.
KOiK04453.
OMAiTECIQTL.
OrthoDBiEOG091G1312.
PhylomeDBiP61244.
TreeFamiTF318841.

Family and domain databases

Gene3Di4.10.280.10. 1 hit.
InterProiIPR011598. bHLH_dom.
[Graphical view]
PfamiPF00010. HLH. 1 hit.
[Graphical view]
SMARTiSM00353. HLH. 1 hit.
[Graphical view]
SUPFAMiSSF47459. SSF47459. 1 hit.
PROSITEiPS50888. BHLH. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.
Isoform 1 (identifier: P61244-1) [UniParc]FASTAAdd to basket
Also known as: Long

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSDNDDIEVE SDEEQPRFQS AADKRAHHNA LERKRRDHIK DSFHSLRDSV
60 70 80 90 100
PSLQGEKASR AQILDKATEY IQYMRRKNHT HQQDIDDLKR QNALLEQQVR
110 120 130 140 150
ALEKARSSAQ LQTNYPSSDN SLYTNAKGST ISAFDGGSDS SSESEPEEPQ
160
SRKKLRMEAS
Length:160
Mass (Da):18,275
Last modified:May 10, 2004 - v1
Checksum:iEB10F3137727A56F
GO
Isoform 2 (identifier: P61244-2) [UniParc] [UniParc]FASTAAdd to basket
Also known as: Short

The sequence of this isoform differs from the canonical sequence as follows:
     13-21: Missing.

Show »
Length:151
Mass (Da):17,202
Checksum:iCB69F6F5F39793FA
GO
Isoform 3 (identifier: P61244-3) [UniParc] [UniParc]FASTAAdd to basket
Also known as: Delta-Max

The sequence of this isoform differs from the canonical sequence as follows:
     99-160: VRALEKARSSAQLQTNYPSSDNSLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS → GESES

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:103
Mass (Da):12,099
Checksum:i49DC1A0441FFA301
GO
Isoform 4 (identifier: P61244-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     99-160: VRALEKARSS...SRKKLRMEAS → GEHPSSWGSW...VRASHGVCAQ

Show »
Length:134
Mass (Da):15,395
Checksum:iA2FFD0B98CF93275
GO
Isoform 5 (identifier: P61244-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     58-160: ASRAQILDKA...SRKKLRMEAS → LYFLFWKLCT...QVHKKKECKI

Note: No experimental confirmation available.
Show »
Length:96
Mass (Da):11,455
Checksum:iD380F721DCF2D6C8
GO
Isoform 6 (identifier: P61244-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     58-160: ASRAQILDKA...SRKKLRMEAS → GTKMKLTLPPVFPYEHLPFPTVFCHG

Note: No experimental confirmation available.
Show »
Length:83
Mass (Da):9,599
Checksum:iFE0E966237003D47
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_00211713 – 21Missing in isoform 2. 3 Publications9
Alternative sequenceiVSP_04343058 – 160ASRAQ…RMEAS → LYFLFWKLCTPVLHRQSLMQ KCHTFISSYQVHKKKECKI in isoform 5. 1 PublicationAdd BLAST103
Alternative sequenceiVSP_04766158 – 160ASRAQ…RMEAS → GTKMKLTLPPVFPYEHLPFP TVFCHG in isoform 6. CuratedAdd BLAST103
Alternative sequenceiVSP_00211899 – 160VRALE…RMEAS → GESES in isoform 3. 2 PublicationsAdd BLAST62
Alternative sequenceiVSP_04318399 – 160VRALE…RMEAS → GEHPSSWGSWPCCAPARSGF GTWACRVRASHGVCAQ in isoform 4. 1 PublicationAdd BLAST62

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M64240 mRNA. Translation: AAA36200.1.
M64240 mRNA. Translation: AAA36201.1.
X66867 Genomic DNA. Translation: CAA47337.1.
X66867 Genomic DNA. Translation: CAA47338.1.
X66867 Genomic DNA. Translation: CAA47339.1.
X60287 mRNA. Translation: CAA42827.1.
AK290130 mRNA. Translation: BAF82819.1.
AK290929 mRNA. Translation: BAF83618.1.
AK292189 mRNA. Translation: BAF84878.1.
AK292630 mRNA. Translation: BAF85319.1.
AL139022 Genomic DNA. No translation available.
CH471061 Genomic DNA. Translation: EAW80899.1.
CH471061 Genomic DNA. Translation: EAW80901.1.
CH471061 Genomic DNA. Translation: EAW80903.1.
CH471061 Genomic DNA. Translation: EAW80904.1.
BC003525 mRNA. Translation: AAH03525.1.
BC004516 mRNA. Translation: AAH04516.1.
BC013669 mRNA. Translation: AAH13669.1.
BC027924 mRNA. Translation: AAH27924.1.
CCDSiCCDS41965.1. [P61244-3]
CCDS9770.1. [P61244-6]
CCDS9771.1.
CCDS9772.1. [P61244-2]
CCDS9774.1. [P61244-5]
PIRiA38431.
A42611.
B38431.
S33118.
RefSeqiNP_001257997.1. NM_001271068.1.
NP_002373.3. NM_002382.4. [P61244-1]
NP_660087.1. NM_145112.2. [P61244-2]
NP_660088.1. NM_145113.2. [P61244-3]
NP_660089.1. NM_145114.2. [P61244-5]
NP_932061.1. NM_197957.3. [P61244-6]
UniGeneiHs.285354.

Genome annotation databases

EnsembliENST00000246163; ENSP00000246163; ENSG00000125952. [P61244-5]
ENST00000284165; ENSP00000284165; ENSG00000125952. [P61244-4]
ENST00000341653; ENSP00000342482; ENSG00000125952. [P61244-6]
ENST00000358402; ENSP00000351175; ENSG00000125952. [P61244-2]
ENST00000358664; ENSP00000351490; ENSG00000125952. [P61244-1]
ENST00000394606; ENSP00000378104; ENSG00000125952. [P61244-3]
ENST00000553928; ENSP00000451907; ENSG00000125952. [P61244-3]
ENST00000556979; ENSP00000452378; ENSG00000125952. [P61244-3]
ENST00000618858; ENSP00000480127; ENSG00000125952. [P61244-3]
GeneIDi4149.
KEGGihsa:4149.
UCSCiuc001xic.3. human.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M64240 mRNA. Translation: AAA36200.1.
M64240 mRNA. Translation: AAA36201.1.
X66867 Genomic DNA. Translation: CAA47337.1.
X66867 Genomic DNA. Translation: CAA47338.1.
X66867 Genomic DNA. Translation: CAA47339.1.
X60287 mRNA. Translation: CAA42827.1.
AK290130 mRNA. Translation: BAF82819.1.
AK290929 mRNA. Translation: BAF83618.1.
AK292189 mRNA. Translation: BAF84878.1.
AK292630 mRNA. Translation: BAF85319.1.
AL139022 Genomic DNA. No translation available.
CH471061 Genomic DNA. Translation: EAW80899.1.
CH471061 Genomic DNA. Translation: EAW80901.1.
CH471061 Genomic DNA. Translation: EAW80903.1.
CH471061 Genomic DNA. Translation: EAW80904.1.
BC003525 mRNA. Translation: AAH03525.1.
BC004516 mRNA. Translation: AAH04516.1.
BC013669 mRNA. Translation: AAH13669.1.
BC027924 mRNA. Translation: AAH27924.1.
CCDSiCCDS41965.1. [P61244-3]
CCDS9770.1. [P61244-6]
CCDS9771.1.
CCDS9772.1. [P61244-2]
CCDS9774.1. [P61244-5]
PIRiA38431.
A42611.
B38431.
S33118.
RefSeqiNP_001257997.1. NM_001271068.1.
NP_002373.3. NM_002382.4. [P61244-1]
NP_660087.1. NM_145112.2. [P61244-2]
NP_660088.1. NM_145113.2. [P61244-3]
NP_660089.1. NM_145114.2. [P61244-5]
NP_932061.1. NM_197957.3. [P61244-6]
UniGeneiHs.285354.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1AN2X-ray2.90A22-107[»]
1HLOX-ray2.80A/B20-92[»]
1NKPX-ray1.80B/E23-102[»]
1NLWX-ray2.00B/E24-99[»]
1R05NMR-A/B22-103[»]
DisProtiDP00084.
ProteinModelPortaliP61244.
SMRiP61244.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110319. 99 interactors.
DIPiDIP-28145N.
IntActiP61244. 98 interactors.
MINTiMINT-1468374.
STRINGi9606.ENSP00000351490.

Chemistry databases

BindingDBiP61244.
ChEMBLiCHEMBL1250363.

PTM databases

iPTMnetiP61244.
PhosphoSitePlusiP61244.

Polymorphism and mutation databases

DMDMi47117704.

Proteomic databases

EPDiP61244.
MaxQBiP61244.
PaxDbiP61244.
PeptideAtlasiP61244.
PRIDEiP61244.

Protocols and materials databases

DNASUi4149.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000246163; ENSP00000246163; ENSG00000125952. [P61244-5]
ENST00000284165; ENSP00000284165; ENSG00000125952. [P61244-4]
ENST00000341653; ENSP00000342482; ENSG00000125952. [P61244-6]
ENST00000358402; ENSP00000351175; ENSG00000125952. [P61244-2]
ENST00000358664; ENSP00000351490; ENSG00000125952. [P61244-1]
ENST00000394606; ENSP00000378104; ENSG00000125952. [P61244-3]
ENST00000553928; ENSP00000451907; ENSG00000125952. [P61244-3]
ENST00000556979; ENSP00000452378; ENSG00000125952. [P61244-3]
ENST00000618858; ENSP00000480127; ENSG00000125952. [P61244-3]
GeneIDi4149.
KEGGihsa:4149.
UCSCiuc001xic.3. human.

Organism-specific databases

CTDi4149.
DisGeNETi4149.
GeneCardsiMAX.
GeneReviewsiMAX.
HGNCiHGNC:6913. MAX.
HPAiCAB000328.
HPA003474.
MalaCardsiMAX.
MIMi154950. gene.
171300. phenotype.
neXtProtiNX_P61244.
OpenTargetsiENSG00000125952.
Orphaneti29072. Hereditary pheochromocytoma-paraganglioma.
PharmGKBiPA30656.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2483. Eukaryota.
ENOG4111V1C. LUCA.
GeneTreeiENSGT00530000064011.
HOGENOMiHOG000293257.
HOVERGENiHBG008542.
InParanoidiP61244.
KOiK04453.
OMAiTECIQTL.
OrthoDBiEOG091G1312.
PhylomeDBiP61244.
TreeFamiTF318841.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000125952-MONOMER.
ReactomeiR-HSA-69202. Cyclin E associated events during G1/S transition.
R-HSA-69656. Cyclin A:Cdk2-associated events at S phase entry.
SignaLinkiP61244.
SIGNORiP61244.

Miscellaneous databases

ChiTaRSiMAX. human.
EvolutionaryTraceiP61244.
GeneWikiiMAX_(gene).
GenomeRNAii4149.
PMAP-CutDBP61244.
PROiP61244.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000125952.
CleanExiHS_MAX.
ExpressionAtlasiP61244. baseline and differential.
GenevisibleiP61244. HS.

Family and domain databases

Gene3Di4.10.280.10. 1 hit.
InterProiIPR011598. bHLH_dom.
[Graphical view]
PfamiPF00010. HLH. 1 hit.
[Graphical view]
SMARTiSM00353. HLH. 1 hit.
[Graphical view]
SUPFAMiSSF47459. SSF47459. 1 hit.
PROSITEiPS50888. BHLH. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiMAX_HUMAN
AccessioniPrimary (citable) accession number: P61244
Secondary accession number(s): A6NH73
, A8K265, A8K4G4, A8K824, P25912, P52163, Q14803, Q96CY8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 10, 2004
Last sequence update: May 10, 2004
Last modified: November 30, 2016
This is version 155 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.