Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein yippee-like 3

Gene

YPEL3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Involved in proliferation and apoptosis in myeloid precursor cells.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi23ZincPROSITE-ProRule annotation1
Metal bindingi26ZincPROSITE-ProRule annotation1
Metal bindingi79ZincPROSITE-ProRule annotation1
Metal bindingi82ZincPROSITE-ProRule annotation1

GO - Molecular functioni

GO - Biological processi

  • positive regulation of cellular senescence Source: HGNC

Keywordsi

LigandMetal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Protein yippee-like 3
Gene namesi
Name:YPEL3
ORF Names:FKSG5
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

HGNCiHGNC:18327. YPEL3.

Subcellular locationi

  • Nucleusnucleolus 1 Publication

GO - Cellular componenti

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi83719.
OpenTargetsiENSG00000090238.
PharmGKBiPA134985092.

Polymorphism and mutation databases

BioMutaiYPEL3.
DMDMi47117782.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002123891 – 119Protein yippee-like 3Add BLAST119

Post-translational modificationi

Probably ubiquitinated leading to its degradation by the proteasome.By similarity

Keywords - PTMi

Ubl conjugation

Proteomic databases

PaxDbiP61236.
PeptideAtlasiP61236.
PRIDEiP61236.

Expressioni

Tissue specificityi

Widely expressed.1 Publication

Gene expression databases

BgeeiENSG00000090238.
CleanExiHS_YPEL3.
ExpressionAtlasiP61236. baseline and differential.
GenevisibleiP61236. HS.

Organism-specific databases

HPAiHPA030501.
HPA045621.

Interactioni

Protein-protein interaction databases

BioGridi123740. 10 interactors.
IntActiP61236. 2 interactors.
STRINGi9606.ENSP00000381821.

Structurei

3D structure databases

ProteinModelPortaliP61236.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini19 – 116YippeePROSITE-ProRule annotationAdd BLAST98

Sequence similaritiesi

Belongs to the yippee family.Curated

Phylogenomic databases

eggNOGiKOG3399. Eukaryota.
ENOG4111VJ1. LUCA.
GeneTreeiENSGT00390000008364.
HOGENOMiHOG000184254.
HOVERGENiHBG054215.
InParanoidiP61236.
OMAiADIHCES.
OrthoDBiEOG091G0XLE.
PhylomeDBiP61236.
TreeFamiTF313936.

Family and domain databases

InterProiView protein in InterPro
IPR034751. Yippee.
IPR004910. Yippee/Mis18/Cereblon.
PfamiView protein in Pfam
PF03226. Yippee-Mis18. 1 hit.
PROSITEiView protein in PROSITE
PS51792. YIPPEE. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P61236-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVRISKPKTF QAYLDDCHRR YSCAHCRAHL ANHDDLISKS FQGSQGRAYL
60 70 80 90 100
FNSVVNVGCG PAEERVLLTG LHAVADIHCE NCKTTLGWKY EQAFESSQKY
110
KEGKYIIELN HMIKDNGWD
Length:119
Mass (Da):13,608
Last modified:May 10, 2004 - v1
Checksum:iA35E852DEB1FFBB4
GO
Isoform 2 (identifier: P61236-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MCVAQVLTAHLLPPRQALGSLCSPWAAPRVGPLPPAPAM

Show »
Length:157
Mass (Da):17,478
Checksum:iDE3E720F14F48C09
GO

Sequence cautioni

The sequence EAW79925 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0372761M → MCVAQVLTAHLLPPRQALGS LCSPWAAPRVGPLPPAPAM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB098737 Genomic DNA. Translation: BAD51378.1.
AF305622 mRNA. Translation: AAL09365.1.
AC012645 Genomic DNA. No translation available.
CH471238 Genomic DNA. Translation: EAW79925.1. Different initiation.
BC005009 mRNA. Translation: AAH05009.3.
BC050664 mRNA. Translation: AAH50664.2.
CCDSiCCDS42147.1. [P61236-2]
CCDS45459.1. [P61236-1]
RefSeqiNP_001138996.1. NM_001145524.1. [P61236-1]
NP_113665.3. NM_031477.4. [P61236-2]
UniGeneiHs.513491.

Genome annotation databases

EnsembliENST00000398838; ENSP00000381818; ENSG00000090238. [P61236-1]
ENST00000398841; ENSP00000381821; ENSG00000090238. [P61236-2]
ENST00000563788; ENSP00000457976; ENSG00000090238. [P61236-1]
ENST00000566595; ENSP00000456427; ENSG00000090238. [P61236-1]
GeneIDi83719.
KEGGihsa:83719.
UCSCiuc002dwl.3. human. [P61236-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.

Entry informationi

Entry nameiYPEL3_HUMAN
AccessioniPrimary (citable) accession number: P61236
Secondary accession number(s): Q65Z99
, Q86VK6, Q9BSJ4, Q9CQB6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 10, 2004
Last sequence update: May 10, 2004
Last modified: April 12, 2017
This is version 101 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families