P61236 (YPEL3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 60.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Protein yippee-like 3 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 119 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Involved in proliferation and apoptosis in myeloid precursor cells By similarity. |
| Subcellular location | |
| Tissue specificity | Widely expressed. Ref.1 |
| Post-translational modification | Probably ubiquitinated leading to its degradation by the proteasome By similarity. |
| Sequence similarities | Belongs to the yippee family. |
| Sequence caution | The sequence EAW79925.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing |
| PTM | Ubl conjugation |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular component | nucleolus Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P61236-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P61236-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MCVAQVLTAHLLPPRQALGSLCSPWAAPRVGPLPPAPAM |
Sequence annotation (Features)
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification and characterization of a novel gene family YPEL in a wide spectrum of eukaryotic species." Hosono K., Sasaki T., Minoshima S., Shimizu N. Gene 340:31-43(2004) [PubMed: 15556292] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [2] | "Cloning and characterization of FKSG5, a novel gene related to DiGeorge syndrome." Wang Y.-G. Submitted (SEP-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | "The sequence and analysis of duplication-rich human chromosome 16." Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J. Pennacchio L.A.Nature 432:988-994(2004) [PubMed: 15616553] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Pancreas. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB098737 Genomic DNA. Translation: BAD51378.1. AF305622 mRNA. Translation: AAL09365.1. AC012645 Genomic DNA. No translation available. CH471238 Genomic DNA. Translation: EAW79925.1. Different initiation. BC005009 mRNA. Translation: AAH05009.3. BC050664 mRNA. Translation: AAH50664.2. |
| IPI | IPI00640143. IPI00873358. |
| RefSeq | NP_001138996.1. NM_001145524.1. NP_113665.3. NM_031477.4. |
| UniGene | Hs.513491. |
3D structure databases | |
| ProteinModelPortal | P61236. |
| ModBase | Search... |
Polymorphism databases | |
| DMDM | 47117782. |
Proteomic databases | |
| PRIDE | P61236. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000398838; ENSP00000381818; ENSG00000090238. ENST00000398841; ENSP00000381821; ENSG00000090238. |
| GeneID | 83719. |
| KEGG | hsa:83719. |
| UCSC | uc002dwl.1. human. |
Organism-specific databases | |
| CTD | 83719. |
| GeneCards | GC16M030103. |
| H-InvDB | HIX0012932. |
| HGNC | HGNC:18327. YPEL3. |
| HPA | HPA030501. |
| MIM | 609724. gene. |
| neXtProt | NX_P61236. |
| PharmGKB | PA134985092. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG04871. |
| GeneTree | ENSGT00390000008364. |
| HOGENOM | HBG524054. |
| HOVERGEN | HBG054215. |
| InParanoid | P61236. |
| OMA | QVLTAHL. |
| OrthoDB | EOG4HQDKR. |
| PhylomeDB | P61236. |
Gene expression databases | |
| ArrayExpress | P61236. |
| Bgee | P61236. |
| CleanEx | HS_YPEL3. |
| Genevestigator | P61236. |
| GermOnline | ENSG00000090238. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR004910. Yippee. [Graphical view] |
| Pfam | PF03226. Yippee. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| SOURCE | Search... |
Entry information
| Entry name | YPEL3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P61236 Secondary accession number(s): Q65Z99 Q9CQB6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 16 Human chromosome 16: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with