Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Fibroblast growth factor 12

Gene

Fgf12

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Involved in nervous system development and function. Promote neuronal excitability by elevating the voltage dependence of neuronal sodium channel SCN8A fast inactivation.By similarity

GO - Molecular functioni

  • ion channel binding Source: BHF-UCL
  • sodium channel regulator activity Source: BHF-UCL

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Growth factor

Enzyme and pathway databases

ReactomeiR-RNO-5576892. Phase 0 - rapid depolarisation.

Names & Taxonomyi

Protein namesi
Recommended name:
Fibroblast growth factor 12
Short name:
FGF-12
Alternative name(s):
Fibroblast growth factor homologous factor 1
Short name:
FHF-1
Gene namesi
Name:Fgf12
Synonyms:Fhf1
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Chromosome 11

Organism-specific databases

RGDi620163. Fgf12.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001476061 – 243Fibroblast growth factor 12Add BLAST243

Proteomic databases

PaxDbiP61150.
PRIDEiP61150.

PTM databases

iPTMnetiP61150.
PhosphoSitePlusiP61150.

Expressioni

Gene expression databases

BgeeiENSRNOG00000001931.
ExpressionAtlasiP61150. baseline and differential.
GenevisibleiP61150. RN.

Interactioni

Subunit structurei

Interacts with the C-terminal region of SCN9A.1 Publication

GO - Molecular functioni

  • ion channel binding Source: BHF-UCL

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000002650.

Structurei

3D structure databases

ProteinModelPortaliP61150.
SMRiP61150.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi11 – 38Bipartite nuclear localization signalSequence analysisAdd BLAST28

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG3885. Eukaryota.
ENOG4111IPH. LUCA.
GeneTreeiENSGT00760000118859.
HOGENOMiHOG000290676.
HOVERGENiHBG007580.
InParanoidiP61150.
KOiK04358.
OMAiYSSEVFT.
OrthoDBiEOG091G0NAY.
PhylomeDBiP61150.
TreeFamiTF330751.

Family and domain databases

CDDicd00058. FGF. 1 hit.
InterProiIPR008996. Cytokine_IL1-like.
IPR028254. FGF12.
IPR002209. Fibroblast_GF_fam.
IPR028142. IL-1_fam/FGF_fam.
[Graphical view]
PANTHERiPTHR11486. PTHR11486. 1 hit.
PTHR11486:SF17. PTHR11486:SF17. 1 hit.
PfamiPF00167. FGF. 1 hit.
[Graphical view]
PRINTSiPR00263. HBGFFGF.
PR00262. IL1HBGF.
SMARTiSM00442. FGF. 1 hit.
[Graphical view]
SUPFAMiSSF50353. SSF50353. 1 hit.
PROSITEiPS00247. HBGF_FGF. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P61150-1) [UniParc]FASTAAdd to basket
Also known as: Fhf1a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAAIASSLI RQKRQARESN SDRVSASKRR SSPSKDGRSL CERHVLGVFS
60 70 80 90 100
KVRFCSGRKR PVRRRPEPQL KGIVTRLFSQ QGYFLQMHPD GTIDGTKDEN
110 120 130 140 150
SDYTLFNLIP VGLRVVAIQG VKASLYVAMN GEGYLYSSDV FTPECKFKES
160 170 180 190 200
VFENYYVIYS STLYRQQESG RAWFLGLNKE GQIMKGNRVK KTKPSSHFVP
210 220 230 240
KPIEVCMYRE PSLHEIGEKQ GRSRKSSGTP TMNGGKVVNQ DST
Length:243
Mass (Da):27,399
Last modified:May 10, 2004 - v1
Checksum:i773ED10B5BDD033C
GO
Isoform 2 (identifier: P61150-2) [UniParc]FASTAAdd to basket
Also known as: Fhf1b

The sequence of this isoform differs from the canonical sequence as follows:
     1-66: MAAAIASSLIRQKRQARESNSDRVSASKRRSSPSKDGRSLCERHVLGVFSKVRFCSGRKRPVRRRP → MESK

Show »
Length:181
Mass (Da):20,424
Checksum:iE150D8758875C8B7
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0102241 – 66MAAAI…VRRRP → MESK in isoform 2. 1 PublicationAdd BLAST66

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB079374 mRNA. Translation: BAB84568.1.
AF348446 mRNA. Translation: AAK59870.1.
RefSeqiNP_570827.1. NM_130814.1.
XP_017453344.1. XM_017597855.1. [P61150-2]
UniGeneiRn.45965.

Genome annotation databases

EnsembliENSRNOT00000002650; ENSRNOP00000002650; ENSRNOG00000001931. [P61150-1]
GeneIDi170630.
KEGGirno:170630.
UCSCiRGD:620163. rat. [P61150-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB079374 mRNA. Translation: BAB84568.1.
AF348446 mRNA. Translation: AAK59870.1.
RefSeqiNP_570827.1. NM_130814.1.
XP_017453344.1. XM_017597855.1. [P61150-2]
UniGeneiRn.45965.

3D structure databases

ProteinModelPortaliP61150.
SMRiP61150.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000002650.

PTM databases

iPTMnetiP61150.
PhosphoSitePlusiP61150.

Proteomic databases

PaxDbiP61150.
PRIDEiP61150.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSRNOT00000002650; ENSRNOP00000002650; ENSRNOG00000001931. [P61150-1]
GeneIDi170630.
KEGGirno:170630.
UCSCiRGD:620163. rat. [P61150-1]

Organism-specific databases

CTDi2257.
RGDi620163. Fgf12.

Phylogenomic databases

eggNOGiKOG3885. Eukaryota.
ENOG4111IPH. LUCA.
GeneTreeiENSGT00760000118859.
HOGENOMiHOG000290676.
HOVERGENiHBG007580.
InParanoidiP61150.
KOiK04358.
OMAiYSSEVFT.
OrthoDBiEOG091G0NAY.
PhylomeDBiP61150.
TreeFamiTF330751.

Enzyme and pathway databases

ReactomeiR-RNO-5576892. Phase 0 - rapid depolarisation.

Miscellaneous databases

PROiP61150.

Gene expression databases

BgeeiENSRNOG00000001931.
ExpressionAtlasiP61150. baseline and differential.
GenevisibleiP61150. RN.

Family and domain databases

CDDicd00058. FGF. 1 hit.
InterProiIPR008996. Cytokine_IL1-like.
IPR028254. FGF12.
IPR002209. Fibroblast_GF_fam.
IPR028142. IL-1_fam/FGF_fam.
[Graphical view]
PANTHERiPTHR11486. PTHR11486. 1 hit.
PTHR11486:SF17. PTHR11486:SF17. 1 hit.
PfamiPF00167. FGF. 1 hit.
[Graphical view]
PRINTSiPR00263. HBGFFGF.
PR00262. IL1HBGF.
SMARTiSM00442. FGF. 1 hit.
[Graphical view]
SUPFAMiSSF50353. SSF50353. 1 hit.
PROSITEiPS00247. HBGF_FGF. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiFGF12_RAT
AccessioniPrimary (citable) accession number: P61150
Secondary accession number(s): O35339
, P70376, Q924B4, Q92912, Q93001
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 10, 2004
Last sequence update: May 10, 2004
Last modified: November 30, 2016
This is version 93 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.