Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P61018

- RAB4B_HUMAN

UniProt

P61018 - RAB4B_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Ras-related protein Rab-4B

Gene

RAB4B

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Protein transport. Probably involved in vesicular traffic By similarity.By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi15 – 239GTP
Nucleotide bindingi63 – 675GTPBy similarity
Nucleotide bindingi121 – 1244GTP
Nucleotide bindingi151 – 1533GTP

GO - Molecular functioni

  1. GTP binding Source: UniProtKB-KW

GO - Biological processi

  1. glucose import Source: UniProt
  2. protein transport Source: UniProtKB-KW
  3. small GTPase mediated signal transduction Source: InterPro
Complete GO annotation...

Keywords - Biological processi

Protein transport, Transport

Keywords - Ligandi

GTP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Ras-related protein Rab-4B
Gene namesi
Name:RAB4B
ORF Names:PP1596
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 19

Organism-specific databases

HGNCiHGNC:9782. RAB4B.

Subcellular locationi

Cell membrane Curated; Lipid-anchor Curated; Cytoplasmic side Curated

GO - Cellular componenti

  1. insulin-responsive compartment Source: UniProt
  2. perinuclear region of cytoplasm Source: UniProt
  3. plasma membrane Source: UniProtKB-KW
  4. recycling endosome Source: UniProt
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA34142.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11Removed1 Publication
Chaini2 – 213212Ras-related protein Rab-4BPRO_0000121099Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylalanine1 Publication
Lipidationi211 – 2111S-geranylgeranyl cysteineBy similarity
Modified residuei213 – 2131Cysteine methyl esterBy similarity
Lipidationi213 – 2131S-geranylgeranyl cysteineBy similarity

Keywords - PTMi

Acetylation, Lipoprotein, Methylation, Prenylation

Proteomic databases

MaxQBiP61018.
PaxDbiP61018.
PRIDEiP61018.

PTM databases

PhosphoSiteiP61018.

Expressioni

Gene expression databases

BgeeiP61018.
CleanExiHS_RAB4B.
ExpressionAtlasiP61018. baseline and differential.
GenevestigatoriP61018.

Interactioni

Protein-protein interaction databases

BioGridi119816. 2 interactions.
STRINGi9606.ENSP00000349560.

Structurei

Secondary structure

1
213
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi7 – 1610Combined sources
Helixi21 – 299Combined sources
Beta strandi45 – 528Combined sources
Beta strandi55 – 628Combined sources
Helixi67 – 704Combined sources
Helixi75 – 784Combined sources
Beta strandi82 – 898Combined sources
Helixi93 – 975Combined sources
Helixi99 – 10911Combined sources
Beta strandi115 – 1217Combined sources
Helixi123 – 1286Combined sources
Helixi133 – 14210Combined sources
Beta strandi146 – 1505Combined sources
Turni152 – 1543Combined sources
Helixi158 – 17417Combined sources
Helixi180 – 1823Combined sources

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2O52X-ray2.20A/B6-183[»]
ProteinModelPortaliP61018.
SMRiP61018. Positions 6-183.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP61018.

Family & Domainsi

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi37 – 459Effector regionBy similarity

Sequence similaritiesi

Belongs to the small GTPase superfamily. Rab family.Curated

Phylogenomic databases

eggNOGiCOG1100.
GeneTreeiENSGT00760000118841.
HOGENOMiHOG000233968.
HOVERGENiHBG009351.
InParanoidiP61018.
KOiK07880.
OMAiFKDHSQH.
OrthoDBiEOG7QK0CV.
PhylomeDBiP61018.
TreeFamiTF300032.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR027417. P-loop_NTPase.
IPR005225. Small_GTP-bd_dom.
IPR001806. Small_GTPase.
IPR003579. Small_GTPase_Rab_type.
[Graphical view]
PfamiPF00071. Ras. 1 hit.
[Graphical view]
PRINTSiPR00449. RASTRNSFRMNG.
SMARTiSM00175. RAB. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
TIGRFAMsiTIGR00231. small_GTP. 1 hit.
PROSITEiPS51419. RAB. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P61018-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAETYDFLFK FLVIGSAGTG KSCLLHQFIE NKFKQDSNHT IGVEFGSRVV
60 70 80 90 100
NVGGKTVKLQ IWDTAGQERF RSVTRSYYRG AAGALLVYDI TSRETYNSLA
110 120 130 140 150
AWLTDARTLA SPNIVVILCG NKKDLDPERE VTFLEASRFA QENELMFLET
160 170 180 190 200
SALTGENVEE AFLKCARTIL NKIDSGELDP ERMGSGIQYG DASLRQLRQP
210
RSAQAVAPQP CGC
Length:213
Mass (Da):23,587
Last modified:April 26, 2004 - v1
Checksum:i0C3D76DC3285DB98
GO
Isoform 2 (identifier: P61018-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-5: MAETY → MSVSLPLTVMVRERDWIGIHLFSLYLSLPVGIPDFGSIWS

Note: No experimental confirmation available.

Show »
Length:248
Mass (Da):27,506
Checksum:i69EBDC77A684EAC6
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti4 – 63TYD → DRH in AAP97171. 1 PublicationCurated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 55MAETY → MSVSLPLTVMVRERDWIGIH LFSLYLSLPVGIPDFGSIWS in isoform 2. 1 PublicationVSP_013567

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF087861 mRNA. Translation: AAP97171.1.
AF165522 mRNA. Translation: AAD45923.1.
AF217985 mRNA. Translation: AAG17228.1.
AF498935 mRNA. Translation: AAM21083.1.
BC046927 mRNA. Translation: AAH46927.1.
CCDSiCCDS33030.1. [P61018-1]
RefSeqiNP_057238.3. NM_016154.4. [P61018-1]
UniGeneiHs.631539.
Hs.730737.

Genome annotation databases

EnsembliENST00000357052; ENSP00000349560; ENSG00000167578. [P61018-1]
ENST00000594800; ENSP00000470246; ENSG00000167578. [P61018-1]
GeneIDi53916.
KEGGihsa:53916.
UCSCiuc002opd.2. human. [P61018-1]
uc002opf.2. human. [P61018-2]

Polymorphism databases

DMDMi46577635.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF087861 mRNA. Translation: AAP97171.1 .
AF165522 mRNA. Translation: AAD45923.1 .
AF217985 mRNA. Translation: AAG17228.1 .
AF498935 mRNA. Translation: AAM21083.1 .
BC046927 mRNA. Translation: AAH46927.1 .
CCDSi CCDS33030.1. [P61018-1 ]
RefSeqi NP_057238.3. NM_016154.4. [P61018-1 ]
UniGenei Hs.631539.
Hs.730737.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2O52 X-ray 2.20 A/B 6-183 [» ]
ProteinModelPortali P61018.
SMRi P61018. Positions 6-183.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 119816. 2 interactions.
STRINGi 9606.ENSP00000349560.

PTM databases

PhosphoSitei P61018.

Polymorphism databases

DMDMi 46577635.

Proteomic databases

MaxQBi P61018.
PaxDbi P61018.
PRIDEi P61018.

Protocols and materials databases

DNASUi 53916.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000357052 ; ENSP00000349560 ; ENSG00000167578 . [P61018-1 ]
ENST00000594800 ; ENSP00000470246 ; ENSG00000167578 . [P61018-1 ]
GeneIDi 53916.
KEGGi hsa:53916.
UCSCi uc002opd.2. human. [P61018-1 ]
uc002opf.2. human. [P61018-2 ]

Organism-specific databases

CTDi 53916.
GeneCardsi GC19P041284.
HGNCi HGNC:9782. RAB4B.
MIMi 612945. gene.
neXtProti NX_P61018.
PharmGKBi PA34142.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG1100.
GeneTreei ENSGT00760000118841.
HOGENOMi HOG000233968.
HOVERGENi HBG009351.
InParanoidi P61018.
KOi K07880.
OMAi FKDHSQH.
OrthoDBi EOG7QK0CV.
PhylomeDBi P61018.
TreeFami TF300032.

Miscellaneous databases

EvolutionaryTracei P61018.
GenomeRNAii 53916.
NextBioi 56222.
PROi P61018.
SOURCEi Search...

Gene expression databases

Bgeei P61018.
CleanExi HS_RAB4B.
ExpressionAtlasi P61018. baseline and differential.
Genevestigatori P61018.

Family and domain databases

Gene3Di 3.40.50.300. 1 hit.
InterProi IPR027417. P-loop_NTPase.
IPR005225. Small_GTP-bd_dom.
IPR001806. Small_GTPase.
IPR003579. Small_GTPase_Rab_type.
[Graphical view ]
Pfami PF00071. Ras. 1 hit.
[Graphical view ]
PRINTSi PR00449. RASTRNSFRMNG.
SMARTi SM00175. RAB. 1 hit.
[Graphical view ]
SUPFAMi SSF52540. SSF52540. 1 hit.
TIGRFAMsi TIGR00231. small_GTP. 1 hit.
PROSITEi PS51419. RAB. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and characterization of a novel human cDNA homologous to R.norvegicus rab4b mRNA."
    Chu J.H., Yu L., Cui W.C., Bi A.D., Huang J., Zhao S.Y.
    Submitted (JUL-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "Novel genes expressed in hematopoietic stem/progenitor cells from myelodysplastic syndrome patients."
    Huang C., Wu T., Xu S., Gu W., Wang Y., Han Z., Chen Z.
    Submitted (JUL-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Hematopoietic stem cell.
  3. "Large-scale cDNA transfection screening for genes related to cancer development and progression."
    Wan D., Gong Y., Qin W., Zhang P., Li J., Wei L., Zhou X., Li H., Qiu X., Zhong F., He L., Yu J., Yao G., Jiang H., Qian L., Yu Y., Shu H., Chen X.
    , Xu H., Guo M., Pan Z., Chen Y., Ge C., Yang S., Gu J.
    Proc. Natl. Acad. Sci. U.S.A. 101:15724-15729(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  4. "cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org)."
    Puhl H.L. III, Ikeda S.R., Aronstam R.S.
    Submitted (APR-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Mammary gland.
  6. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  7. "Comparative large-scale characterisation of plant vs. mammal proteins reveals similar and idiosyncratic N-alpha acetylation features."
    Bienvenut W.V., Sumpton D., Martinez A., Lilla S., Espagne C., Meinnel T., Giglione C.
    Mol. Cell. Proteomics 11:M111.015131-M111.015131(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].
  8. "Crystal structure of human RAB4B in complex with GDP."
    Structural genomics consortium (SGC)
    Submitted (FEB-2009) to the PDB data bank
    Cited for: X-RAY CRYSTALLOGRAPHY (2.2 ANGSTROMS) OF 6-183 IN COMPLEX WITH GDP.

Entry informationi

Entry nameiRAB4B_HUMAN
AccessioniPrimary (citable) accession number: P61018
Secondary accession number(s): P22750, Q7Z514, Q9HBR6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 26, 2004
Last sequence update: April 26, 2004
Last modified: October 29, 2014
This is version 106 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3