P61018 (RAB4B_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 95.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Ras-related protein Rab-4B | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 213 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Protein transport. Probably involved in vesicular traffic By similarity. |
| Subcellular location | Cell membrane; Lipid-anchor; Cytoplasmic side Potential. |
| Sequence similarities | Belongs to the small GTPase superfamily. Rab family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Protein transport Transport |
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing |
| Ligand | GTP-binding Nucleotide-binding |
| PTM | Lipoprotein Methylation Prenylation |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | protein transport Inferred from electronic annotation. Source: UniProtKB-KW small GTPase mediated signal transductionInferred from electronic annotation. Source: InterPro vesicle-mediated transportNon-traceable author statement. Source: UniProtKB |
| Cellular_component | intracellular Non-traceable author statement. Source: UniProtKB plasma membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | GTP binding Inferred from electronic annotation. Source: UniProtKB-KW GTPase activityNon-traceable author statement. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P61018-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P61018-2) The sequence of this isoform differs from the canonical sequence as follows: 1-5: MAETY → MSVSLPLTVMVRERDWIGIHLFSLYLSLPVGIPDFGSIWS | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 213 | 213 | Ras-related protein Rab-4B | PRO_0000121099 | |||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 15 – 23 | 9 | GTP | ||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 63 – 67 | 5 | GTP By similarity | ||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 121 – 124 | 4 | GTP | ||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 151 – 153 | 3 | GTP | ||||||||||||||||||||||||||||||||||||||
| Motif | 37 – 45 | 9 | Effector region By similarity | ||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||
| Modified residue | 213 | 1 | Cysteine methyl ester By similarity | ||||||||||||||||||||||||||||||||||||||
| Lipidation | 211 | 1 | S-geranylgeranyl cysteine By similarity | ||||||||||||||||||||||||||||||||||||||
| Lipidation | 213 | 1 | S-geranylgeranyl cysteine By similarity | ||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 5 | 5 | MAETY → MSVSLPLTVMVRERDWIGIH LFSLYLSLPVGIPDFGSIWS in isoform 2. | VSP_013567 | |||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 4 – 6 | 3 | TYD → DRH in AAP97171. Ref.1 | ||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||
| Beta strand | 7 – 16 | 10 | |||||||||||||||||||||||||||||||||||||||
| Helix | 21 – 29 | 9 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 45 – 52 | 8 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 55 – 62 | 8 | |||||||||||||||||||||||||||||||||||||||
| Helix | 67 – 70 | 4 | |||||||||||||||||||||||||||||||||||||||
| Helix | 75 – 78 | 4 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 82 – 89 | 8 | |||||||||||||||||||||||||||||||||||||||
| Helix | 93 – 97 | 5 | |||||||||||||||||||||||||||||||||||||||
| Helix | 99 – 109 | 11 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 115 – 121 | 7 | |||||||||||||||||||||||||||||||||||||||
| Helix | 123 – 128 | 6 | |||||||||||||||||||||||||||||||||||||||
| Helix | 133 – 142 | 10 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 146 – 150 | 5 | |||||||||||||||||||||||||||||||||||||||
| Turn | 152 – 154 | 3 | |||||||||||||||||||||||||||||||||||||||
| Helix | 158 – 174 | 17 | |||||||||||||||||||||||||||||||||||||||
| Helix | 180 – 182 | 3 | |||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and characterization of a novel human cDNA homologous to R.norvegicus rab4b mRNA." Chu J.H., Yu L., Cui W.C., Bi A.D., Huang J., Zhao S.Y. Submitted (JUL-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Novel genes expressed in hematopoietic stem/progenitor cells from myelodysplastic syndrome patients." Huang C., Wu T., Xu S., Gu W., Wang Y., Han Z., Chen Z. Submitted (JUL-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Hematopoietic stem cell. |
| [3] | "Large-scale cDNA transfection screening for genes related to cancer development and progression." Wan D., Gong Y., Qin W., Zhang P., Li J., Wei L., Zhou X., Li H., Qiu X., Zhong F., He L., Yu J., Yao G., Jiang H., Qian L., Yu Y., Shu H., Chen X. Gu J.Proc. Natl. Acad. Sci. U.S.A. 101:15724-15729(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [4] | "cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org)." Puhl H.L. III, Ikeda S.R., Aronstam R.S. Submitted (APR-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Mammary gland. |
| [6] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [7] | "Crystal structure of human RAB4B in complex with GDP." Structural genomics consortium (SGC) Submitted (FEB-2009) to the PDB data bank Cited for: X-RAY CRYSTALLOGRAPHY (2.2 ANGSTROMS) OF 6-183 IN COMPLEX WITH GDP. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF087861 mRNA. Translation: AAP97171.1. AF165522 mRNA. Translation: AAD45923.1. AF217985 mRNA. Translation: AAG17228.1. AF498935 mRNA. Translation: AAM21083.1. BC046927 mRNA. Translation: AAH46927.1. | ||||||||||||
| IPI | IPI00187143. IPI00477489. | ||||||||||||
| RefSeq | NP_057238.3. NM_016154.4. | ||||||||||||
| UniGene | Hs.631539. Hs.730737. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | P61018. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| STRING | 9606.ENSP00000349560. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | P61018. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 46577635. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | P61018. | ||||||||||||
| PRIDE | P61018. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 53916. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000357052; ENSP00000349560; ENSG00000167578. ENST00000594800; ENSP00000470246; ENSG00000167578. | ||||||||||||
| GeneID | 53916. | ||||||||||||
| KEGG | hsa:53916. | ||||||||||||
| UCSC | uc002opd.2. human. uc002opf.2. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 53916. | ||||||||||||
| GeneCards | GC19P041284. | ||||||||||||
| HGNC | HGNC:9782. RAB4B. | ||||||||||||
| MIM | 612945. gene. | ||||||||||||
| neXtProt | NX_P61018. | ||||||||||||
| PharmGKB | PA34142. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | COG1100. | ||||||||||||
| HOGENOM | HOG000233968. | ||||||||||||
| HOVERGEN | HBG009351. | ||||||||||||
| InParanoid | P61018. | ||||||||||||
| KO | K07880. | ||||||||||||
| OMA | SPNIVIL. | ||||||||||||
| OrthoDB | EOG4WM4VM. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | P61018. | ||||||||||||
| Bgee | P61018. | ||||||||||||
| CleanEx | HS_RAB4B. | ||||||||||||
| Genevestigator | P61018. | ||||||||||||
| GermOnline | ENSG00000167578. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR027417. P-loop_NTPase. IPR005225. Small_GTP-bd_dom. IPR001806. Small_GTPase. IPR003579. Small_GTPase_Rab_type. [Graphical view] | ||||||||||||
| Pfam | PF00071. Ras. 1 hit. [Graphical view] | ||||||||||||
| PRINTS | PR00449. RASTRNSFRMNG. | ||||||||||||
| SMART | SM00175. RAB. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF52540. SSF52540. 1 hit. | ||||||||||||
| TIGRFAMs | TIGR00231. small_GTP. 1 hit. | ||||||||||||
| PROSITE | PS51419. RAB. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| EvolutionaryTrace | P61018. | ||||||||||||
| GenomeRNAi | 53916. | ||||||||||||
| NextBio | 56222. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | RAB4B_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P61018 Secondary accession number(s): P22750, Q7Z514, Q9HBR6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 19 Human chromosome 19: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
