Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P61018

- RAB4B_HUMAN

UniProt

P61018 - RAB4B_HUMAN

Protein

Ras-related protein Rab-4B

Gene

RAB4B

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 105 (01 Oct 2014)
      Sequence version 1 (26 Apr 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Protein transport. Probably involved in vesicular traffic By similarity.By similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi15 – 239GTP
    Nucleotide bindingi63 – 675GTPBy similarity
    Nucleotide bindingi121 – 1244GTP
    Nucleotide bindingi151 – 1533GTP

    GO - Molecular functioni

    1. GTP binding Source: UniProtKB-KW

    GO - Biological processi

    1. glucose import Source: UniProt
    2. protein transport Source: UniProtKB-KW
    3. small GTPase mediated signal transduction Source: InterPro

    Keywords - Biological processi

    Protein transport, Transport

    Keywords - Ligandi

    GTP-binding, Nucleotide-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Ras-related protein Rab-4B
    Gene namesi
    Name:RAB4B
    ORF Names:PP1596
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 19

    Organism-specific databases

    HGNCiHGNC:9782. RAB4B.

    Subcellular locationi

    Cell membrane Curated; Lipid-anchor Curated; Cytoplasmic side Curated

    GO - Cellular componenti

    1. insulin-responsive compartment Source: UniProt
    2. perinuclear region of cytoplasm Source: UniProt
    3. plasma membrane Source: UniProtKB-SubCell
    4. recycling endosome Source: UniProt

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA34142.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Initiator methioninei1 – 11Removed1 Publication
    Chaini2 – 213212Ras-related protein Rab-4BPRO_0000121099Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei2 – 21N-acetylalanine1 Publication
    Lipidationi211 – 2111S-geranylgeranyl cysteineBy similarity
    Modified residuei213 – 2131Cysteine methyl esterBy similarity
    Lipidationi213 – 2131S-geranylgeranyl cysteineBy similarity

    Keywords - PTMi

    Acetylation, Lipoprotein, Methylation, Prenylation

    Proteomic databases

    MaxQBiP61018.
    PaxDbiP61018.
    PRIDEiP61018.

    PTM databases

    PhosphoSiteiP61018.

    Expressioni

    Gene expression databases

    ArrayExpressiP61018.
    BgeeiP61018.
    CleanExiHS_RAB4B.
    GenevestigatoriP61018.

    Interactioni

    Protein-protein interaction databases

    BioGridi119816. 2 interactions.
    STRINGi9606.ENSP00000349560.

    Structurei

    Secondary structure

    1
    213
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi7 – 1610
    Helixi21 – 299
    Beta strandi45 – 528
    Beta strandi55 – 628
    Helixi67 – 704
    Helixi75 – 784
    Beta strandi82 – 898
    Helixi93 – 975
    Helixi99 – 10911
    Beta strandi115 – 1217
    Helixi123 – 1286
    Helixi133 – 14210
    Beta strandi146 – 1505
    Turni152 – 1543
    Helixi158 – 17417
    Helixi180 – 1823

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2O52X-ray2.20A/B6-183[»]
    ProteinModelPortaliP61018.
    SMRiP61018. Positions 6-183.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiP61018.

    Family & Domainsi

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi37 – 459Effector regionBy similarity

    Sequence similaritiesi

    Belongs to the small GTPase superfamily. Rab family.Curated

    Phylogenomic databases

    eggNOGiCOG1100.
    HOGENOMiHOG000233968.
    HOVERGENiHBG009351.
    InParanoidiP61018.
    KOiK07880.
    OMAiFKDHSQH.
    OrthoDBiEOG7QK0CV.
    PhylomeDBiP61018.
    TreeFamiTF300032.

    Family and domain databases

    Gene3Di3.40.50.300. 1 hit.
    InterProiIPR027417. P-loop_NTPase.
    IPR005225. Small_GTP-bd_dom.
    IPR001806. Small_GTPase.
    IPR003579. Small_GTPase_Rab_type.
    [Graphical view]
    PfamiPF00071. Ras. 1 hit.
    [Graphical view]
    PRINTSiPR00449. RASTRNSFRMNG.
    SMARTiSM00175. RAB. 1 hit.
    [Graphical view]
    SUPFAMiSSF52540. SSF52540. 1 hit.
    TIGRFAMsiTIGR00231. small_GTP. 1 hit.
    PROSITEiPS51419. RAB. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P61018-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAETYDFLFK FLVIGSAGTG KSCLLHQFIE NKFKQDSNHT IGVEFGSRVV    50
    NVGGKTVKLQ IWDTAGQERF RSVTRSYYRG AAGALLVYDI TSRETYNSLA 100
    AWLTDARTLA SPNIVVILCG NKKDLDPERE VTFLEASRFA QENELMFLET 150
    SALTGENVEE AFLKCARTIL NKIDSGELDP ERMGSGIQYG DASLRQLRQP 200
    RSAQAVAPQP CGC 213
    Length:213
    Mass (Da):23,587
    Last modified:April 26, 2004 - v1
    Checksum:i0C3D76DC3285DB98
    GO
    Isoform 2 (identifier: P61018-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-5: MAETY → MSVSLPLTVMVRERDWIGIHLFSLYLSLPVGIPDFGSIWS

    Note: No experimental confirmation available.

    Show »
    Length:248
    Mass (Da):27,506
    Checksum:i69EBDC77A684EAC6
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti4 – 63TYD → DRH in AAP97171. 1 PublicationCurated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 55MAETY → MSVSLPLTVMVRERDWIGIH LFSLYLSLPVGIPDFGSIWS in isoform 2. 1 PublicationVSP_013567

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF087861 mRNA. Translation: AAP97171.1.
    AF165522 mRNA. Translation: AAD45923.1.
    AF217985 mRNA. Translation: AAG17228.1.
    AF498935 mRNA. Translation: AAM21083.1.
    BC046927 mRNA. Translation: AAH46927.1.
    CCDSiCCDS33030.1. [P61018-1]
    RefSeqiNP_057238.3. NM_016154.4. [P61018-1]
    UniGeneiHs.631539.
    Hs.730737.

    Genome annotation databases

    EnsembliENST00000357052; ENSP00000349560; ENSG00000167578. [P61018-1]
    ENST00000594800; ENSP00000470246; ENSG00000167578. [P61018-1]
    GeneIDi53916.
    KEGGihsa:53916.
    UCSCiuc002opd.2. human. [P61018-1]
    uc002opf.2. human. [P61018-2]

    Polymorphism databases

    DMDMi46577635.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF087861 mRNA. Translation: AAP97171.1 .
    AF165522 mRNA. Translation: AAD45923.1 .
    AF217985 mRNA. Translation: AAG17228.1 .
    AF498935 mRNA. Translation: AAM21083.1 .
    BC046927 mRNA. Translation: AAH46927.1 .
    CCDSi CCDS33030.1. [P61018-1 ]
    RefSeqi NP_057238.3. NM_016154.4. [P61018-1 ]
    UniGenei Hs.631539.
    Hs.730737.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2O52 X-ray 2.20 A/B 6-183 [» ]
    ProteinModelPortali P61018.
    SMRi P61018. Positions 6-183.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 119816. 2 interactions.
    STRINGi 9606.ENSP00000349560.

    PTM databases

    PhosphoSitei P61018.

    Polymorphism databases

    DMDMi 46577635.

    Proteomic databases

    MaxQBi P61018.
    PaxDbi P61018.
    PRIDEi P61018.

    Protocols and materials databases

    DNASUi 53916.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000357052 ; ENSP00000349560 ; ENSG00000167578 . [P61018-1 ]
    ENST00000594800 ; ENSP00000470246 ; ENSG00000167578 . [P61018-1 ]
    GeneIDi 53916.
    KEGGi hsa:53916.
    UCSCi uc002opd.2. human. [P61018-1 ]
    uc002opf.2. human. [P61018-2 ]

    Organism-specific databases

    CTDi 53916.
    GeneCardsi GC19P041284.
    HGNCi HGNC:9782. RAB4B.
    MIMi 612945. gene.
    neXtProti NX_P61018.
    PharmGKBi PA34142.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG1100.
    HOGENOMi HOG000233968.
    HOVERGENi HBG009351.
    InParanoidi P61018.
    KOi K07880.
    OMAi FKDHSQH.
    OrthoDBi EOG7QK0CV.
    PhylomeDBi P61018.
    TreeFami TF300032.

    Miscellaneous databases

    EvolutionaryTracei P61018.
    GenomeRNAii 53916.
    NextBioi 56222.
    PROi P61018.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P61018.
    Bgeei P61018.
    CleanExi HS_RAB4B.
    Genevestigatori P61018.

    Family and domain databases

    Gene3Di 3.40.50.300. 1 hit.
    InterProi IPR027417. P-loop_NTPase.
    IPR005225. Small_GTP-bd_dom.
    IPR001806. Small_GTPase.
    IPR003579. Small_GTPase_Rab_type.
    [Graphical view ]
    Pfami PF00071. Ras. 1 hit.
    [Graphical view ]
    PRINTSi PR00449. RASTRNSFRMNG.
    SMARTi SM00175. RAB. 1 hit.
    [Graphical view ]
    SUPFAMi SSF52540. SSF52540. 1 hit.
    TIGRFAMsi TIGR00231. small_GTP. 1 hit.
    PROSITEi PS51419. RAB. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and characterization of a novel human cDNA homologous to R.norvegicus rab4b mRNA."
      Chu J.H., Yu L., Cui W.C., Bi A.D., Huang J., Zhao S.Y.
      Submitted (JUL-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "Novel genes expressed in hematopoietic stem/progenitor cells from myelodysplastic syndrome patients."
      Huang C., Wu T., Xu S., Gu W., Wang Y., Han Z., Chen Z.
      Submitted (JUL-1999) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Hematopoietic stem cell.
    3. "Large-scale cDNA transfection screening for genes related to cancer development and progression."
      Wan D., Gong Y., Qin W., Zhang P., Li J., Wei L., Zhou X., Li H., Qiu X., Zhong F., He L., Yu J., Yao G., Jiang H., Qian L., Yu Y., Shu H., Chen X.
      , Xu H., Guo M., Pan Z., Chen Y., Ge C., Yang S., Gu J.
      Proc. Natl. Acad. Sci. U.S.A. 101:15724-15729(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    4. "cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org)."
      Puhl H.L. III, Ikeda S.R., Aronstam R.S.
      Submitted (APR-2002) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Mammary gland.
    6. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    7. "Comparative large-scale characterisation of plant vs. mammal proteins reveals similar and idiosyncratic N-alpha acetylation features."
      Bienvenut W.V., Sumpton D., Martinez A., Lilla S., Espagne C., Meinnel T., Giglione C.
      Mol. Cell. Proteomics 11:M111.015131-M111.015131(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].
    8. "Crystal structure of human RAB4B in complex with GDP."
      Structural genomics consortium (SGC)
      Submitted (FEB-2009) to the PDB data bank
      Cited for: X-RAY CRYSTALLOGRAPHY (2.2 ANGSTROMS) OF 6-183 IN COMPLEX WITH GDP.

    Entry informationi

    Entry nameiRAB4B_HUMAN
    AccessioniPrimary (citable) accession number: P61018
    Secondary accession number(s): P22750, Q7Z514, Q9HBR6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 26, 2004
    Last sequence update: April 26, 2004
    Last modified: October 1, 2014
    This is version 105 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 19
      Human chromosome 19: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3