Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ras-related protein Rab-4B

Gene

RAB4B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Protein transport. Probably involved in vesicular traffic (By similarity).By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi15 – 23GTPCombined sources9
Nucleotide bindingi63 – 67GTPBy similarity5
Nucleotide bindingi121 – 124GTPCombined sources4
Nucleotide bindingi151 – 153GTPCombined sources3

GO - Molecular functioni

GO - Biological processi

  • glucose import Source: UniProtKB
  • protein transport Source: UniProtKB-KW
  • regulation of endocytosis Source: GO_Central
  • small GTPase mediated signal transduction Source: InterPro
Complete GO annotation...

Keywords - Biological processi

Protein transport, Transport

Keywords - Ligandi

GTP-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000167578-MONOMER.
ReactomeiR-HSA-6798695. Neutrophil degranulation.
R-HSA-8875656. MET receptor recycling.

Names & Taxonomyi

Protein namesi
Recommended name:
Ras-related protein Rab-4B
Gene namesi
Name:RAB4B
ORF Names:PP1596
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:9782. RAB4B.

Subcellular locationi

GO - Cellular componenti

  • insulin-responsive compartment Source: UniProtKB
  • perinuclear region of cytoplasm Source: UniProtKB
  • plasma membrane Source: UniProtKB-SubCell
  • recycling endosome Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi53916.
OpenTargetsiENSG00000167578.
ENSG00000171570.
PharmGKBiPA34142.

Polymorphism and mutation databases

BioMutaiRAB4B.
DMDMi46577635.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00001210992 – 213Ras-related protein Rab-4BAdd BLAST212

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1
Modified residuei185PhosphoserineBy similarity1
Modified residuei193PhosphoserineCombined sources1
Lipidationi211S-geranylgeranyl cysteineBy similarity1
Modified residuei213Cysteine methyl esterBy similarity1
Lipidationi213S-geranylgeranyl cysteineBy similarity1

Keywords - PTMi

Acetylation, Lipoprotein, Methylation, Phosphoprotein, Prenylation

Proteomic databases

EPDiP61018.
MaxQBiP61018.
PaxDbiP61018.
PeptideAtlasiP61018.
PRIDEiP61018.

PTM databases

iPTMnetiP61018.
PhosphoSitePlusiP61018.
SwissPalmiP61018.

Expressioni

Gene expression databases

BgeeiENSG00000167578.
CleanExiHS_RAB4B.
ExpressionAtlasiP61018. baseline and differential.
GenevisibleiP61018. HS.

Organism-specific databases

HPAiCAB004685.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
EXOC5Q8IW243EBI-10218066,EBI-10171392

Protein-protein interaction databases

BioGridi119816. 20 interactors.
IntActiP61018. 21 interactors.
STRINGi9606.ENSP00000469872.

Structurei

Secondary structure

1213
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi7 – 16Combined sources10
Helixi21 – 29Combined sources9
Beta strandi45 – 52Combined sources8
Beta strandi55 – 62Combined sources8
Helixi67 – 70Combined sources4
Helixi75 – 78Combined sources4
Beta strandi82 – 89Combined sources8
Helixi93 – 97Combined sources5
Helixi99 – 109Combined sources11
Beta strandi115 – 121Combined sources7
Helixi123 – 128Combined sources6
Helixi133 – 142Combined sources10
Beta strandi146 – 150Combined sources5
Turni152 – 154Combined sources3
Helixi158 – 174Combined sources17
Helixi180 – 182Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2O52X-ray2.20A/B6-183[»]
ProteinModelPortaliP61018.
SMRiP61018.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP61018.

Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi37 – 45Effector regionBy similarity9

Sequence similaritiesi

Belongs to the small GTPase superfamily. Rab family.Curated

Phylogenomic databases

eggNOGiKOG0086. Eukaryota.
ENOG410XQ9X. LUCA.
GeneTreeiENSGT00760000118841.
HOGENOMiHOG000233968.
HOVERGENiHBG009351.
InParanoidiP61018.
KOiK07880.
OMAiETYDFLM.
OrthoDBiEOG091G0QOB.
PhylomeDBiP61018.
TreeFamiTF300032.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR027417. P-loop_NTPase.
IPR005225. Small_GTP-bd_dom.
IPR001806. Small_GTPase.
[Graphical view]
PfamiPF00071. Ras. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
TIGRFAMsiTIGR00231. small_GTP. 1 hit.
PROSITEiPS51419. RAB. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P61018-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAETYDFLFK FLVIGSAGTG KSCLLHQFIE NKFKQDSNHT IGVEFGSRVV
60 70 80 90 100
NVGGKTVKLQ IWDTAGQERF RSVTRSYYRG AAGALLVYDI TSRETYNSLA
110 120 130 140 150
AWLTDARTLA SPNIVVILCG NKKDLDPERE VTFLEASRFA QENELMFLET
160 170 180 190 200
SALTGENVEE AFLKCARTIL NKIDSGELDP ERMGSGIQYG DASLRQLRQP
210
RSAQAVAPQP CGC
Length:213
Mass (Da):23,587
Last modified:April 26, 2004 - v1
Checksum:i0C3D76DC3285DB98
GO
Isoform 2 (identifier: P61018-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-5: MAETY → MSVSLPLTVMVRERDWIGIHLFSLYLSLPVGIPDFGSIWS

Note: No experimental confirmation available.
Show »
Length:248
Mass (Da):27,506
Checksum:i69EBDC77A684EAC6
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti4 – 6TYD → DRH in AAP97171 (Ref. 1) Curated3

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0135671 – 5MAETY → MSVSLPLTVMVRERDWIGIH LFSLYLSLPVGIPDFGSIWS in isoform 2. 1 Publication5

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF087861 mRNA. Translation: AAP97171.1.
AF165522 mRNA. Translation: AAD45923.1.
AF217985 mRNA. Translation: AAG17228.1.
AF498935 mRNA. Translation: AAM21083.1.
BC046927 mRNA. Translation: AAH46927.1.
CCDSiCCDS33030.1. [P61018-1]
RefSeqiNP_057238.3. NM_016154.4. [P61018-1]
UniGeneiHs.631539.
Hs.730737.

Genome annotation databases

EnsembliENST00000357052; ENSP00000349560; ENSG00000167578. [P61018-1]
ENST00000594800; ENSP00000470246; ENSG00000167578. [P61018-1]
GeneIDi53916.
KEGGihsa:53916.
UCSCiuc002opd.2. human. [P61018-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF087861 mRNA. Translation: AAP97171.1.
AF165522 mRNA. Translation: AAD45923.1.
AF217985 mRNA. Translation: AAG17228.1.
AF498935 mRNA. Translation: AAM21083.1.
BC046927 mRNA. Translation: AAH46927.1.
CCDSiCCDS33030.1. [P61018-1]
RefSeqiNP_057238.3. NM_016154.4. [P61018-1]
UniGeneiHs.631539.
Hs.730737.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2O52X-ray2.20A/B6-183[»]
ProteinModelPortaliP61018.
SMRiP61018.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119816. 20 interactors.
IntActiP61018. 21 interactors.
STRINGi9606.ENSP00000469872.

PTM databases

iPTMnetiP61018.
PhosphoSitePlusiP61018.
SwissPalmiP61018.

Polymorphism and mutation databases

BioMutaiRAB4B.
DMDMi46577635.

Proteomic databases

EPDiP61018.
MaxQBiP61018.
PaxDbiP61018.
PeptideAtlasiP61018.
PRIDEiP61018.

Protocols and materials databases

DNASUi53916.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000357052; ENSP00000349560; ENSG00000167578. [P61018-1]
ENST00000594800; ENSP00000470246; ENSG00000167578. [P61018-1]
GeneIDi53916.
KEGGihsa:53916.
UCSCiuc002opd.2. human. [P61018-1]

Organism-specific databases

CTDi53916.
DisGeNETi53916.
GeneCardsiRAB4B.
HGNCiHGNC:9782. RAB4B.
HPAiCAB004685.
MIMi612945. gene.
neXtProtiNX_P61018.
OpenTargetsiENSG00000167578.
ENSG00000171570.
PharmGKBiPA34142.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0086. Eukaryota.
ENOG410XQ9X. LUCA.
GeneTreeiENSGT00760000118841.
HOGENOMiHOG000233968.
HOVERGENiHBG009351.
InParanoidiP61018.
KOiK07880.
OMAiETYDFLM.
OrthoDBiEOG091G0QOB.
PhylomeDBiP61018.
TreeFamiTF300032.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000167578-MONOMER.
ReactomeiR-HSA-6798695. Neutrophil degranulation.
R-HSA-8875656. MET receptor recycling.

Miscellaneous databases

EvolutionaryTraceiP61018.
GenomeRNAii53916.
PROiP61018.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000167578.
CleanExiHS_RAB4B.
ExpressionAtlasiP61018. baseline and differential.
GenevisibleiP61018. HS.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR027417. P-loop_NTPase.
IPR005225. Small_GTP-bd_dom.
IPR001806. Small_GTPase.
[Graphical view]
PfamiPF00071. Ras. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
TIGRFAMsiTIGR00231. small_GTP. 1 hit.
PROSITEiPS51419. RAB. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiRAB4B_HUMAN
AccessioniPrimary (citable) accession number: P61018
Secondary accession number(s): P22750, Q7Z514, Q9HBR6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 26, 2004
Last sequence update: April 26, 2004
Last modified: November 30, 2016
This is version 128 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.