Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P61018 (RAB4B_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 102. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Ras-related protein Rab-4B
Gene names
Name:RAB4B
ORF Names:PP1596
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length213 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Protein transport. Probably involved in vesicular traffic By similarity.

Subcellular location

Cell membrane; Lipid-anchor; Cytoplasmic side Potential.

Sequence similarities

Belongs to the small GTPase superfamily. Rab family.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: P61018-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: P61018-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-5: MAETY → MSVSLPLTVMVRERDWIGIHLFSLYLSLPVGIPDFGSIWS
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Initiator methionine11Removed Ref.7
Chain2 – 213212Ras-related protein Rab-4B
PRO_0000121099

Regions

Nucleotide binding15 – 239GTP
Nucleotide binding63 – 675GTP By similarity
Nucleotide binding121 – 1244GTP
Nucleotide binding151 – 1533GTP
Motif37 – 459Effector region By similarity

Amino acid modifications

Modified residue21N-acetylalanine Ref.7
Modified residue2131Cysteine methyl ester By similarity
Lipidation2111S-geranylgeranyl cysteine By similarity
Lipidation2131S-geranylgeranyl cysteine By similarity

Natural variations

Alternative sequence1 – 55MAETY → MSVSLPLTVMVRERDWIGIH LFSLYLSLPVGIPDFGSIWS in isoform 2.
VSP_013567

Experimental info

Sequence conflict4 – 63TYD → DRH in AAP97171. Ref.1

Secondary structure

................................. 213
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified April 26, 2004. Version 1.
Checksum: 0C3D76DC3285DB98

FASTA21323,587
        10         20         30         40         50         60 
MAETYDFLFK FLVIGSAGTG KSCLLHQFIE NKFKQDSNHT IGVEFGSRVV NVGGKTVKLQ 

        70         80         90        100        110        120 
IWDTAGQERF RSVTRSYYRG AAGALLVYDI TSRETYNSLA AWLTDARTLA SPNIVVILCG 

       130        140        150        160        170        180 
NKKDLDPERE VTFLEASRFA QENELMFLET SALTGENVEE AFLKCARTIL NKIDSGELDP 

       190        200        210 
ERMGSGIQYG DASLRQLRQP RSAQAVAPQP CGC 

« Hide

Isoform 2 [UniParc].

Checksum: 69EBDC77A684EAC6
Show »

FASTA24827,506

References

« Hide 'large scale' references
[1]"Cloning and characterization of a novel human cDNA homologous to R.norvegicus rab4b mRNA."
Chu J.H., Yu L., Cui W.C., Bi A.D., Huang J., Zhao S.Y.
Submitted (JUL-2003) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[2]"Novel genes expressed in hematopoietic stem/progenitor cells from myelodysplastic syndrome patients."
Huang C., Wu T., Xu S., Gu W., Wang Y., Han Z., Chen Z.
Submitted (JUL-1999) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Hematopoietic stem cell.
[3]"Large-scale cDNA transfection screening for genes related to cancer development and progression."
Wan D., Gong Y., Qin W., Zhang P., Li J., Wei L., Zhou X., Li H., Qiu X., Zhong F., He L., Yu J., Yao G., Jiang H., Qian L., Yu Y., Shu H., Chen X. expand/collapse author list , Xu H., Guo M., Pan Z., Chen Y., Ge C., Yang S., Gu J.
Proc. Natl. Acad. Sci. U.S.A. 101:15724-15729(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
[4]"cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org)."
Puhl H.L. III, Ikeda S.R., Aronstam R.S.
Submitted (APR-2002) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Brain.
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Mammary gland.
[6]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[7]"Comparative large-scale characterisation of plant vs. mammal proteins reveals similar and idiosyncratic N-alpha acetylation features."
Bienvenut W.V., Sumpton D., Martinez A., Lilla S., Espagne C., Meinnel T., Giglione C.
Mol. Cell. Proteomics 11:M111.015131-M111.015131(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].
[8]"Crystal structure of human RAB4B in complex with GDP."
Structural genomics consortium (SGC)
Submitted (FEB-2009) to the PDB data bank
Cited for: X-RAY CRYSTALLOGRAPHY (2.2 ANGSTROMS) OF 6-183 IN COMPLEX WITH GDP.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF087861 mRNA. Translation: AAP97171.1.
AF165522 mRNA. Translation: AAD45923.1.
AF217985 mRNA. Translation: AAG17228.1.
AF498935 mRNA. Translation: AAM21083.1.
BC046927 mRNA. Translation: AAH46927.1.
RefSeqNP_057238.3. NM_016154.4.
UniGeneHs.631539.
Hs.730737.

3D structure databases

PDBe
RCSB PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
2O52X-ray2.20A/B6-183[»]
ProteinModelPortalP61018.
SMRP61018. Positions 6-183.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid119816. 2 interactions.
STRING9606.ENSP00000349560.

PTM databases

PhosphoSiteP61018.

Polymorphism databases

DMDM46577635.

Proteomic databases

PaxDbP61018.
PRIDEP61018.

Protocols and materials databases

DNASU53916.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000357052; ENSP00000349560; ENSG00000167578. [P61018-1]
ENST00000594800; ENSP00000470246; ENSG00000167578. [P61018-1]
GeneID53916.
KEGGhsa:53916.
UCSCuc002opd.2. human. [P61018-1]
uc002opf.2. human. [P61018-2]

Organism-specific databases

CTD53916.
GeneCardsGC19P041284.
HGNCHGNC:9782. RAB4B.
MIM612945. gene.
neXtProtNX_P61018.
PharmGKBPA34142.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG1100.
HOGENOMHOG000233968.
HOVERGENHBG009351.
InParanoidP61018.
KOK07880.
OMAEAFLKCS.
OrthoDBEOG7QK0CV.
PhylomeDBP61018.
TreeFamTF300032.

Gene expression databases

ArrayExpressP61018.
BgeeP61018.
CleanExHS_RAB4B.
GenevestigatorP61018.

Family and domain databases

Gene3D3.40.50.300. 1 hit.
InterProIPR027417. P-loop_NTPase.
IPR005225. Small_GTP-bd_dom.
IPR001806. Small_GTPase.
IPR003579. Small_GTPase_Rab_type.
[Graphical view]
PfamPF00071. Ras. 1 hit.
[Graphical view]
PRINTSPR00449. RASTRNSFRMNG.
SMARTSM00175. RAB. 1 hit.
[Graphical view]
SUPFAMSSF52540. SSF52540. 1 hit.
TIGRFAMsTIGR00231. small_GTP. 1 hit.
PROSITEPS51419. RAB. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

EvolutionaryTraceP61018.
GenomeRNAi53916.
NextBio56222.
PROP61018.
SOURCESearch...

Entry information

Entry nameRAB4B_HUMAN
AccessionPrimary (citable) accession number: P61018
Secondary accession number(s): P22750, Q7Z514, Q9HBR6
Entry history
Integrated into UniProtKB/Swiss-Prot: April 26, 2004
Last sequence update: April 26, 2004
Last modified: April 16, 2014
This is version 102 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 19

Human chromosome 19: entries, gene names and cross-references to MIM