P60881 (SNP25_RAT) Reviewed, UniProtKB/Swiss-Prot
Last modified
December 14, 2011.
Version 92.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Synaptosomal-associated protein 25 Short name=SNAP-25 Alternative name(s): Super protein Short name=SUP Synaptosomal-associated 25 kDa protein | ||||
| Gene names |
| ||||
| Organism | Rattus norvegicus (Rat) | ||||
| Taxonomic identifier | 10116 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Rattus |
Protein attributes
| Sequence length | 206 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | t-SNARE involved in the molecular regulation of neurotransmitter release. May play an important role in the synaptic function of specific neuronal systems. Associates with proteins involved in vesicle docking and membrane fusion. Regulates plasma membrane recycling through its interaction with CENPF. |
| Subunit structure | Interacts with CENP and OTOF. Found in a complex containing SYT1, SV2B and syntaxin-1 By similarity. Part of the SNARE core complex containing SNAP25, VAMP2 and STX1A. This complex binds CPLX1. Interacts with TRIM9, RIMS1, SNAPIN, and HGS. Binds STXBP6. Found in a ternary complex with STX1A and VAMP8. Ref.9 Ref.11 Ref.12 |
| Subcellular location | Cytoplasm › perinuclear region By similarity. Cell membrane; Lipid-anchor. Cell junction › synapse › synaptosome. Note: Membrane association requires palmitoylation. Expressed throughout cytoplasm, concentrating at the perinuclear region By similarity. Ref.6 Ref.8 |
| Post-translational modification | Palmitoylated. Cys-85 appears to be the main site, and palmitoylation is required for membrane association By similarity. Ref.6 |
| Sequence similarities | Belongs to the SNAP-25 family. Contains 2 t-SNARE coiled-coil homology domains. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| Srcin1 | Q9QXY2 | 3 | EBI-1027214,EBI-1394088 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] Note: Isoforms differ by the usage of two alternative homologous exons (5a and 5b) which encode for positions 56 to 94 and differ only in 9 positions out of 39. | ||||||
| Isoform SNAP-25b (identifier: P60881-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform SNAP-25a (identifier: P60881-2) The sequence of this isoform differs from the canonical sequence as follows: 58-89: ERIEEGMDQINKDMKEAEKNLTDLGKFCGLCV → DRVEEGMNHINQDMKEAEKNLKDLGKCCGLFI |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||
Molecule processing | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 206 | 206 | Synaptosomal-associated protein 25 | PRO_0000213592 | |||||||||
Regions | |||||||||||||
| Domain | 19 – 81 | 63 | t-SNARE coiled-coil homology 1 | ||||||||||
| Domain | 140 – 202 | 63 | t-SNARE coiled-coil homology 2 | ||||||||||
| Region | 1 – 75 | 75 | Interaction with CENPF By similarity | ||||||||||
| Compositional bias | 85 – 92 | 8 | Cys-rich | ||||||||||
Sites | |||||||||||||
| Site | 180 – 181 | 2 | Cleavage; by BONT/E By similarity | ||||||||||
Amino acid modifications | |||||||||||||
| Modified residue | 138 | 1 | Phosphothreonine; by PKC and PKA Ref.7 | ||||||||||
| Modified residue | 187 | 1 | Phosphoserine; by PKC Ref.7 | ||||||||||
| Lipidation | 85 | 1 | S-palmitoyl cysteine By similarity | ||||||||||
| Lipidation | 88 | 1 | S-palmitoyl cysteine By similarity | ||||||||||
| Lipidation | 90 | 1 | S-palmitoyl cysteine By similarity | ||||||||||
| Lipidation | 92 | 1 | S-palmitoyl cysteine By similarity | ||||||||||
Natural variations | |||||||||||||
| Alternative sequence | 58 – 89 | 32 | ERIEE…CGLCV → DRVEEGMNHINQDMKEAEKN LKDLGKCCGLFI in isoform SNAP-25a. | VSP_010020 | |||||||||
Secondary structure | |||||||||||||
Helix Strand Turn | |||||||||||||
| Helix | 7 – 82 | 76 | |||||||||||
| Helix | 142 – 201 | 60 | |||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | Kataoka M. Submitted (MAY-1997) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS SNAP-25A AND SNAP-25B). |
| [2] | "Cloning of the SNAP-25 gene from a rat brain cDNA library." Cho A.R., You K.H. Submitted (MAR-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SNAP-25A). Tissue: Brain. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SNAP-25B). Tissue: Brain. |
| [4] | "SNARE complex proteins, including the cognate pair VAMP-2 and syntaxin-4, are expressed in cultured oligodendrocytes." Madison D.L., Krueger W.H., Cheng D., Trapp B.D., Pfeiffer S.E. J. Neurochem. 72:988-998(1999) [PubMed: 10037470] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 10-190 (ISOFORM SNAP-25B). Tissue: Brain. |
| [5] | Lubec G., Afjehi-Sadat L., Diao W., Kang S.U., Lubec S. Submitted (SEP-2007) to UniProtKB Cited for: PROTEIN SEQUENCE OF 46-69; 84-94; 104-119; 125-136 AND 143-161, MASS SPECTROMETRY. Strain: Sprague-Dawley. Tissue: Brain, Hippocampus and Spinal cord. |
| [6] | "The 25 kDa synaptosomal-associated protein SNAP-25 is the major methionine-rich polypeptide in rapid axonal transport and a major substrate for palmitoylation in adult CNS." Hess D.T., Slater T.M., Wilson M.C., Skene J.H.P. J. Neurosci. 12:4634-4641(1992) [PubMed: 1281490] [Abstract] Cited for: PALMITOYLATION, SUBCELLULAR LOCATION. |
| [7] | "Differential phosphorylation of SNAP-25 in vivo by protein kinase C and protein kinase A." Hepp R., Cabaniols J.-P., Roche P.A. FEBS Lett. 532:52-56(2002) [PubMed: 12459461] [Abstract] Cited for: PHOSPHORYLATION AT THR-138 AND SER-187. |
| [8] | "Differential subcellular localization of SNAP-25a and SNAP-25b RNA transcripts in spinal motoneurons and plasticity in expression after nerve injury." Jacobsson G., Piehl F., Bark I.C., Zhang X., Meister B. Brain Res. Mol. Brain Res. 37:49-62(1996) [PubMed: 8738135] [Abstract] Cited for: SUBCELLULAR LOCATION OF RNA TRANSCRIPTS. |
| [9] | "Hrs-2 is an ATPase implicated in calcium-regulated secretion." Bean A.J., Seifert R., Chen Y.A., Sacks R., Scheller R.H. Nature 385:826-829(1997) [PubMed: 9039916] [Abstract] Cited for: INTERACTION WITH HGS. |
| [10] | "Mixed and non-cognate SNARE complexes. Characterization of assembly and biophysical properties." Fasshauer D., Antonin W., Margittai M., Pabst S., Jahn R. J. Biol. Chem. 274:15440-15446(1999) [PubMed: 10336434] [Abstract] Cited for: IDENTIFICATION IN A TERNARY COMPLEX WITH STX1A AND VAMP8. |
| [11] | "Direct interaction of the Rab3 effector RIM with Ca2+ channels, SNAP-25, and synaptotagmin." Coppola T., Magnin-Luethi S., Perret-Menoud V., Gattesco S., Schiavo G., Regazzi R. J. Biol. Chem. 276:32756-32762(2001) [PubMed: 11438518] [Abstract] Cited for: INTERACTION WITH RIMS1. |
| [12] | "Amisyn, a novel syntaxin-binding protein that may regulate SNARE complex assembly." Scales S.J., Hesser B.A., Masuda E.S., Scheller R.H. J. Biol. Chem. 277:28271-28279(2002) [PubMed: 12145319] [Abstract] Cited for: INTERACTION WITH STXBP6. |
| [13] | "Crystal structure of a SNARE complex involved in synaptic exocytosis at 2.4 A resolution." Sutton R.B., Fasshauer D., Jahn R., Brunger A.T. Nature 395:347-353(1998) [PubMed: 9759724] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.4 ANGSTROMS) OF 1-83 AND 120-206 IN COMPLEX WITH STX1A AND VAMP2. |
| [14] | "Crystal structure and biophysical properties of a complex between the N-terminal SNARE region of SNAP25 and syntaxin 1a." Misura K.M.S., Gonzalez L.C. Jr., May A.P., Scheller R.H., Weis W.I. J. Biol. Chem. 276:41301-41309(2001) [PubMed: 11533035] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS) OF 1-83 IN COMPLEX WITH STX1A. |
| [15] | "High resolution structure, stability, and synaptotagmin binding of a truncated neuronal SNARE complex." Ernst J.A., Brunger A.T. J. Biol. Chem. 278:8630-8636(2003) [PubMed: 12496247] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.45 ANGSTROMS) OF 7-83 AND 141-204 IN COMPLEX WITH STX1A AND VAMP2. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AB003991 mRNA. Translation: BAA20151.1. AB003992 mRNA. Translation: BAA20152.1. AF245227 mRNA. Translation: AAF81202.1. U56262 mRNA. Translation: AAA99826.1. BC087699 mRNA. Translation: AAH87699.1. U56261 mRNA. Translation: AAA99825.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00204644. IPI00231420. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_112253.1. NM_030991.2. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Rn.107689. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | P60881. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMR | P60881. Positions 10-78, 131-204. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DisProt | DP00068. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DIP | DIP-29205N. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | P60881. 6 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MINT | MINT-95953. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | P60881. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | P60881. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
2D gel databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| World-2DPAGE | 0004:P60881. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | P60881. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 25012. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | rno:25012. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 6616. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RGD | 3728. Snap25. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | maNOG08467. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneTree | ENSGT00390000012186. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG056971. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InParanoid | P60881. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | P60881. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | P60881. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSRNOG00000006037. Rattus norvegicus. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR000928. SNAP-25. IPR000727. T_SNARE_dom. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KO | K08508. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00835. SNAP-25. 1 hit. PF05739. SNARE. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00397. t_SNARE. 2 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS50192. T_SNARE. 2 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 605093. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PMAP-CutDB | P60881. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | SNP25_RAT | ||||||||
| Accession | Primary (citable) accession number: P60881 Secondary accession number(s): P13795 Q9BR45 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with