P60880 (SNP25_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 106.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Synaptosomal-associated protein 25 Short name=SNAP-25 Alternative name(s): Super protein Short name=SUP Synaptosomal-associated 25 kDa protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 206 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | t-SNARE involved in the molecular regulation of neurotransmitter release. May play an important role in the synaptic function of specific neuronal systems. Associates with proteins involved in vesicle docking and membrane fusion. Regulates plasma membrane recycling through its interaction with CENPF. |
| Subunit structure | Part of the SNARE core complex containing SNAP25, VAMP2 and STX1A. This complex binds CPLX1. Interacts with CENPF, TRIM9, RIMS1, SNAPIN, OTOF and HGS. Binds STXBP6. Found in a ternary complex with STX1A and VAMP8. Found in a complex containing SYT1, SV2B and syntaxin-1 By similarity. Associates with the BLOC-1 complex. Isoform 1 and isoform 2 interact with BLOC1S6. Interacts with EQTN By similarity. Ref.11 |
| Subcellular location | Cytoplasm › perinuclear region By similarity. Cell membrane; Lipid-anchor. Cell junction › synapse › synaptosome. Note: Membrane association requires palmitoylation. Expressed throughout cytoplasm, concentrating at the perinuclear region By similarity. |
| Tissue specificity | Neurons of the neocortex, hippocampus, piriform cortex, anterior thalamic nuclei, pontine nuclei, and granule cells of the cerebellum. |
| Post-translational modification | Palmitoylated. Cys-85 appears to be the main site, and palmitoylation is required for membrane association By similarity. |
| Miscellaneous | When cloned and expressed in Eschericia coli, where protein palmitoylation does not occur, Cys-85, Cys-88, Cys-90 and Cys-92 in the protein sequence readily form an iron-sulfur cluster instead. |
| Sequence similarities | Belongs to the SNAP-25 family. Contains 2 t-SNARE coiled-coil homology domains. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| ZDHHC17 | Q8IUH5 | 3 | EBI-524785,EBI-524753 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] Note: Isoforms differ by the usage of two alternative homologous exons (5a and 5b) which encode for positions 56 to 94 and differ only in 9 positions out of 39. | ||||||
| Isoform 1 (identifier: P60880-1) Also known as: SNAP-25b; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P60880-2) Also known as: SNAP-25a; The sequence of this isoform differs from the canonical sequence as follows: 58-89: ERIEEGMDQINKDMKEAEKNLTDLGKFCGLCV → DRVEEGMNHINQDMKEAEKNLKDLGKCCGLFI |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||
Molecule processing | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 206 | 206 | Synaptosomal-associated protein 25 | PRO_0000213587 | |||||||||
Regions | |||||||||||||
| Domain | 19 – 81 | 63 | t-SNARE coiled-coil homology 1 | ||||||||||
| Domain | 140 – 202 | 63 | t-SNARE coiled-coil homology 2 | ||||||||||
| Region | 1 – 75 | 75 | Interaction with CENPF By similarity | ||||||||||
| Compositional bias | 85 – 92 | 8 | Cys-rich | ||||||||||
Sites | |||||||||||||
| Site | 180 – 181 | 2 | Cleavage; by BONT/E | ||||||||||
Amino acid modifications | |||||||||||||
| Modified residue | 138 | 1 | Phosphothreonine By similarity | ||||||||||
| Modified residue | 187 | 1 | Phosphoserine By similarity | ||||||||||
| Lipidation | 85 | 1 | S-palmitoyl cysteine By similarity | ||||||||||
| Lipidation | 88 | 1 | S-palmitoyl cysteine By similarity | ||||||||||
| Lipidation | 90 | 1 | S-palmitoyl cysteine By similarity | ||||||||||
| Lipidation | 92 | 1 | S-palmitoyl cysteine By similarity | ||||||||||
Natural variations | |||||||||||||
| Alternative sequence | 58 – 89 | 32 | ERIEE…CGLCV → DRVEEGMNHINQDMKEAEKN LKDLGKCCGLFI in isoform 2. | VSP_006186 | |||||||||
Experimental info | |||||||||||||
| Sequence conflict | 44 | 1 | I → V in BAD97337. Ref.5 | ||||||||||
Secondary structure | |||||||||||||
Helix Strand Turn | |||||||||||||
| Helix | 148 – 167 | 20 | |||||||||||
| Beta strand | 191 – 193 | 3 | |||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Human cDNA clones encoding two different isoforms of the nerve terminal protein SNAP-25." Bark I.C., Wilson M.C. Gene 139:291-292(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). Tissue: Fetal brain and Temporal cortex. |
| [2] | "Cloning and sequence analysis of the human SNAP25 cDNA." Zhao N., Hashida H., Takahashi N., Sakaki Y. Gene 145:313-314(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Tissue: Frontal cortex. |
| [3] | "Insulin-responsive tissues contain the core complex protein SNAP-25 (synaptosomal-associated protein 25) A and B isoforms in addition to syntaxin 4 and synaptobrevins 1 and 2." Jagadish M.N., Fernandez C.S., Hewish D.R., Macaulay S.L., Gough K.H., Grusovin J., Verkuylen A., Cosgrove L., Alafaci A., Frenkel M.J., Ward C.W. Biochem. J. 317:945-954(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING. Tissue: Skeletal muscle. |
| [4] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Amygdala and Hippocampus. |
| [6] | Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S. Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [7] | "The DNA sequence and comparative analysis of human chromosome 20." Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E. Rogers J.Nature 414:865-871(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Eye. |
| [10] | "SNAP-25 is also an iron-sulfur protein." Huang Q., Hong X., Hao Q. FEBS Lett. 582:1431-1436(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PUTATIVE IRON-SULFUR CLUSTER. |
| [11] | "The dysbindin-containing complex (BLOC-1) in brain: developmental regulation, interaction with SNARE proteins and role in neurite outgrowth." Ghiani C.A., Starcevic M., Rodriguez-Fernandez I.A., Nazarian R., Cheli V.T., Chan L.N., Malvar J.S., de Vellis J., Sabatti C., Dell'Angelica E.C. Mol. Psychiatry 15:204-215(2010) Cited for: ASSOCIATION WITH THE BLOC-1 COMPLEX, INTERACTION WITH BLOC1S6. |
| [12] | "Three-dimensional structure of the complexin/SNARE complex." Chen X., Tomchick D.R., Kovrigin E., Arac D., Machius M., Suedhof T.C., Rizo J. Neuron 33:397-409(2002) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.3 ANGSTROMS) OF 11-81 AND 141-202 IN COMPLEX WITH STX1A; CPLX1 AND VAMP2, STRUCTURE BY NMR. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | L19760 mRNA. Translation: AAC37545.1. L19761 mRNA. Translation: AAC37546.1. D21267 mRNA. Translation: BAA22370.1. BT019684 mRNA. Translation: AAV38490.1. AK223617 mRNA. Translation: BAD97337.1. AK289647 mRNA. Translation: BAF82336.1. AK314359 mRNA. Translation: BAG36991.1. AL023913 Genomic DNA. Translation: CAB42860.1. AL023913 Genomic DNA. Translation: CAC34534.1. AL023913 Genomic DNA. Translation: CAD56158.1. CH471133 Genomic DNA. Translation: EAX10346.1. CH471133 Genomic DNA. Translation: EAX10349.1. CH471133 Genomic DNA. Translation: EAX10350.1. CH471133 Genomic DNA. Translation: EAX10352.1. BC010647 mRNA. Translation: AAH10647.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00010470. IPI00107625. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | I53735. I67823. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_003072.2. NM_003081.3. NP_570824.1. NM_130811.2. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.167317. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | P60880. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DIP | DIP-34554N. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | P60880. 9 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MINT | MINT-1403389. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein family/group databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| TCDB | 1.F.1.1.1. synaptosomal vesicle fusion pore (SVF-Pore) family. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | P60880. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DMDM | 46397726. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PaxDb | P60880. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | P60880. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DNASU | 6616. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000254976; ENSP00000254976; ENSG00000132639. ENST00000304886; ENSP00000307341; ENSG00000132639. ENST00000430336; ENSP00000400720; ENSG00000132639. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 6616. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:6616. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc002wnq.2. human. uc002wnr.2. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 6616. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC20P010199. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:11132. SNAP25. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB000360. HPA001830. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 600322. gene. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_P60880. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA35980. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | NOG259235. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG056971. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KO | K08508. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMA | ESADAYQ. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG4X3H29. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhylomeDB | P60880. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | botulinumtoxinpathway. Effects of Botulinum toxin. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_111217. Metabolism. REACT_116125. Disease. REACT_13685. Neuronal System. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | P60880. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_SNAP25. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | P60880. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000132639. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR000928. SNAP-25. IPR000727. T_SNARE_dom. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00835. SNAP-25. 1 hit. PF05739. SNARE. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00397. t_SNARE. 2 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS50192. T_SNARE. 2 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ChiTaRS | SNAP25. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DrugBank | DB00083. Botulinum Toxin Type A. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | P60880. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 6616. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 25761. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PMAP-CutDB | Q5U0B5. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | SNP25_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P60880 Secondary accession number(s): B2RAU4 Q9BR45 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 20 Human chromosome 20: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
