P60880 (SNP25_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 94.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Synaptosomal-associated protein 25 Short name=SNAP-25 Alternative name(s): Super protein Short name=SUP Synaptosomal-associated 25 kDa protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 206 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | t-SNARE involved in the molecular regulation of neurotransmitter release. May play an important role in the synaptic function of specific neuronal systems. Associates with proteins involved in vesicle docking and membrane fusion. Regulates plasma membrane recycling through its interaction with CENPF. |
| Subunit structure | Part of the SNARE core complex containing SNAP25, VAMP2 and STX1A. This complex binds CPLX1. Interacts with CENPF, TRIM9, RIMS1, SNAPIN, OTOF and HGS. Binds STXBP6. Found in a ternary complex with STX1A and VAMP8. Found in a complex containing SYT1, SV2B and syntaxin-1 By similarity. |
| Subcellular location | Cytoplasm › perinuclear region By similarity. Cell membrane; Lipid-anchor. Cell junction › synapse › synaptosome. Note: Membrane association requires palmitoylation. Expressed throughout cytoplasm, concentrating at the perinuclear region By similarity. |
| Tissue specificity | Neurons of the neocortex, hippocampus, piriform cortex, anterior thalamic nuclei, pontine nuclei, and granule cells of the cerebellum. |
| Post-translational modification | Palmitoylated. Cys-85 appears to be the main site, and palmitoylation is required for membrane association By similarity. |
| Miscellaneous | When cloned and expressed in Eschericia coli, where protein palmitoylation does not occur, Cys-85, Cys-88, Cys-90 and Cys-92 in the protein sequence readily form an iron-sulfur cluster instead. |
| Sequence similarities | Belongs to the SNAP-25 family. Contains 2 t-SNARE coiled-coil homology domains. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell junction Cell membrane Cytoplasm Membrane Synapse Synaptosome |
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil Repeat |
| PTM | Lipoprotein Palmitate Phosphoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | energy reserve metabolic process Traceable author statement. Source: Reactome glutamate secretionTraceable author statement. Source: Reactome neurotransmitter uptakeNon-traceable author statement Ref.3. Source: UniProtKB synaptic vesicle docking involved in exocytosisNon-traceable author statement Ref.3. Source: UniProtKB |
| Cellular component | cell junction Inferred from electronic annotation. Source: UniProtKB-KW perinuclear region of cytoplasmInferred from electronic annotation. Source: UniProtKB-SubCell synapseInferred from electronic annotation. Source: UniProtKB-KW synaptosomeInferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| ZDHHC17 | Q8IUH5 | 3 | EBI-524785,EBI-524753 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] Note: Isoforms differ by the usage of two alternative homologous exons (5a and 5b) which encode for positions 56 to 94 and differ only in 9 positions out of 39. | ||||||
| Isoform SNAP-25b (identifier: P60880-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform SNAP-25a (identifier: P60880-2) The sequence of this isoform differs from the canonical sequence as follows: 58-89: ERIEEGMDQINKDMKEAEKNLTDLGKFCGLCV → DRVEEGMNHINQDMKEAEKNLKDLGKCCGLFI |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||
Molecule processing | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 206 | 206 | Synaptosomal-associated protein 25 | PRO_0000213587 | |||||||||
Regions | |||||||||||||
| Domain | 19 – 81 | 63 | t-SNARE coiled-coil homology 1 | ||||||||||
| Domain | 140 – 202 | 63 | t-SNARE coiled-coil homology 2 | ||||||||||
| Region | 1 – 75 | 75 | Interaction with CENPF By similarity | ||||||||||
| Compositional bias | 85 – 92 | 8 | Cys-rich | ||||||||||
Sites | |||||||||||||
| Site | 180 – 181 | 2 | Cleavage; by BONT/E | ||||||||||
Amino acid modifications | |||||||||||||
| Modified residue | 138 | 1 | Phosphothreonine By similarity | ||||||||||
| Modified residue | 187 | 1 | Phosphoserine By similarity | ||||||||||
| Lipidation | 85 | 1 | S-palmitoyl cysteine By similarity | ||||||||||
| Lipidation | 88 | 1 | S-palmitoyl cysteine By similarity | ||||||||||
| Lipidation | 90 | 1 | S-palmitoyl cysteine By similarity | ||||||||||
| Lipidation | 92 | 1 | S-palmitoyl cysteine By similarity | ||||||||||
Natural variations | |||||||||||||
| Alternative sequence | 58 – 89 | 32 | ERIEE…CGLCV → DRVEEGMNHINQDMKEAEKN LKDLGKCCGLFI in isoform SNAP-25a. | VSP_006186 | |||||||||
Experimental info | |||||||||||||
| Sequence conflict | 44 | 1 | I → V in BAD97337. Ref.5 | ||||||||||
Secondary structure | |||||||||||||
Helix Strand Turn | |||||||||||||
| Helix | 11 – 79 | 69 | |||||||||||
| Helix | 141 – 201 | 61 | |||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Human cDNA clones encoding two different isoforms of the nerve terminal protein SNAP-25." Bark I.C., Wilson M.C. Gene 139:291-292(1994) [PubMed: 8112622] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS SNAP-25A AND SNAP-25B). Tissue: Fetal brain and Temporal cortex. |
| [2] | "Cloning and sequence analysis of the human SNAP25 cDNA." Zhao N., Hashida H., Takahashi N., Sakaki Y. Gene 145:313-314(1994) [PubMed: 8056350] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SNAP-25A). Tissue: Frontal cortex. |
| [3] | "Insulin-responsive tissues contain the core complex protein SNAP-25 (synaptosomal-associated protein 25) A and B isoforms in addition to syntaxin 4 and synaptobrevins 1 and 2." Jagadish M.N., Fernandez C.S., Hewish D.R., Macaulay S.L., Gough K.H., Grusovin J., Verkuylen A., Cosgrove L., Alafaci A., Frenkel M.J., Ward C.W. Biochem. J. 317:945-954(1996) [PubMed: 8760387] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING. Tissue: Skeletal muscle. |
| [4] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SNAP-25A). |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS SNAP-25A AND SNAP-25B). Tissue: Amygdala and Hippocampus. |
| [6] | Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S. Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SNAP-25B). Tissue: Brain. |
| [7] | "The DNA sequence and comparative analysis of human chromosome 20." Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E. Rogers J.Nature 414:865-871(2001) [PubMed: 11780052] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SNAP-25A). Tissue: Eye. |
| [10] | "SNAP-25 is also an iron-sulfur protein." Huang Q., Hong X., Hao Q. FEBS Lett. 582:1431-1436(2008) [PubMed: 18375205] [Abstract] Cited for: PUTATIVE IRON-SULFUR CLUSTER. |
| [11] | "Three-dimensional structure of the complexin/SNARE complex." Chen X., Tomchick D.R., Kovrigin E., Arac D., Machius M., Suedhof T.C., Rizo J. Neuron 33:397-409(2002) [PubMed: 11832227] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.3 ANGSTROMS) OF 11-81 AND 141-202 IN COMPLEX WITH STX1A; CPLX1 AND VAMP2, STRUCTURE BY NMR. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | L19760 mRNA. Translation: AAC37545.1. L19761 mRNA. Translation: AAC37546.1. D21267 mRNA. Translation: BAA22370.1. BT019684 mRNA. Translation: AAV38490.1. AK223617 mRNA. Translation: BAD97337.1. AK289647 mRNA. Translation: BAF82336.1. AK314359 mRNA. Translation: BAG36991.1. AL023913 Genomic DNA. Translation: CAB42860.1. AL023913 Genomic DNA. Translation: CAC34534.1. AL023913 Genomic DNA. Translation: CAD56158.1. CH471133 Genomic DNA. Translation: EAX10346.1. CH471133 Genomic DNA. Translation: EAX10349.1. CH471133 Genomic DNA. Translation: EAX10350.1. CH471133 Genomic DNA. Translation: EAX10352.1. BC010647 mRNA. Translation: AAH10647.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00010470. IPI00107625. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | I53735. I67823. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_003072.2. NM_003081.3. NP_570824.1. NM_130811.2. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.167317. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | P60880. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMR | P60880. Positions 10-78, 131-204. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DIP | DIP-34554N. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | P60880. 9 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MINT | MINT-1403389. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | P60880. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein family/group databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| TCDB | 1.F.1.1.1. synaptosomal vesicle fusion pore (SVF-Pore) family. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | P60880. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DMDM | 46397726. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | P60880. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000254976; ENSP00000254976; ENSG00000132639. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 6616. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:6616. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc002wnq.1. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 6616. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC20P010199. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| H-InvDB | HIX0015639. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:11132. SNAP25. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB000360. HPA001830. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 600322. gene. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_P60880. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA35980. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | prNOG16744. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneTree | ENSGT00390000012186. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG056971. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMA | ESADAYQ. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG4X3H29. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhylomeDB | P60880. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | botulinumtoxinpathway. Effects of Botulinum toxin. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_111217. Metabolism. REACT_13685. Neuronal System. REACT_15380. Diabetes pathways. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | P60880. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | P60880. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_SNAP25. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | P60880. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000132639. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR000928. SNAP-25. IPR000727. T_SNARE_dom. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KO | K08508. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00835. SNAP-25. 1 hit. PF05739. SNARE. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00397. t_SNARE. 2 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS50192. T_SNARE. 2 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DrugBank | DB00083. Botulinum Toxin Type A. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 25761. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PMAP-CutDB | P60880. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | SNP25_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P60880 Secondary accession number(s): B2RAU4 Q9BR45 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 20 Human chromosome 20: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with