Reviewed,
UniProtKB/Swiss-Prot P60879 (SNP25_MOUSE)
Last modified
November 3, 2009.
Version 74.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Synaptosomal-associated protein 25 Short name=SNAP-25 Alternative name(s): Synaptosomal-associated 25 kDa protein Super protein Short name=SUP | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus |
Protein attributes
| Sequence length | 206 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | t-SNARE involved in the molecular regulation of neurotransmitter release. May play an important role in the synaptic function of specific neuronal systems. Associates with proteins involved in vesicle docking and membrane fusion. Regulates plasma membrane recycling through its interaction with CENPF. Ref.13 |
| Subunit structure | Part of the SNARE core complex containing SNAP25, VAMP2 and STX1A. This complex binds CPLX1. Interacts with TRIM9, RIMS1, SNAP25BP and HGS. Binds STXBP6. Found in a ternary complex with STX1A and VAMP8 By similarity. Found in a complex containing SYT1, SV2B and syntaxin-1. Interacts with CENPF and OTOF. |
| Subcellular location | Cytoplasm › perinuclear region. Cell membrane; Lipid-anchor. Cell junction › synapse › synaptosome. Note: Membrane association requires palmitoylation. Expressed throughout cytoplasm, concentrating at the perinuclear region. Ref.13 Ref.1 |
| Post-translational modification | Palmitoylated. Cys-85 appears to be the main site, and palmitoylation is required for membrane association. Ref.8 |
| Sequence similarities | Belongs to the SNAP-25 family. Contains 2 t-SNARE coiled-coil homology domains. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell junction Cell membrane Cytoplasm Membrane Synapse Synaptosome |
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil Repeat |
| PTM | Lipoprotein Palmitate Phosphoprotein |
| Technical term | 3D-structure Direct protein sequencing |
| Gene Ontology (GO) | |
| Biological process | neurotransmitter secretion Inferred from mutant phenotype. Source: MGI |
| Cellular component | anchored to membrane Inferred from electronic annotation. Source: UniProtKB-SubCell cell junctionInferred from electronic annotation. Source: UniProtKB-KW perinuclear region of cytoplasmInferred from direct assay. Source: UniProtKB synapseInferred from electronic annotation. Source: UniProtKB-KW synaptosomeInferred from electronic annotation. Source: UniProtKB-SubCell trans-Golgi networkInferred from direct assay. Source: UniProtKB |
| Molecular function | SNARE binding Inferred from direct assay. Source: MGI |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] Note: Isoforms differ by the usage of two alternative homologous exons (5a and 5b) which encode for positions 56 to 94 and differ only in 9 positions out of 39. | ||||||
| Isoform SNAP-25b (identifier: P60879-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform SNAP-25a (identifier: P60879-2) The sequence of this isoform differs from the canonical sequence as follows: 58-89: ERIEEGMDQINKDMKEAEKNLTDLGKFCGLCV → DRVEEGMNHINQDMKEAEKNLKDLGKCCGLFI |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||
Molecule processing | |||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 206 | 206 | Synaptosomal-associated protein 25 | PRO_0000213589 | |||||||||||||
Regions | |||||||||||||||||
| Domain | 19 – 81 | 63 | t-SNARE coiled-coil homology 1 | ||||||||||||||
| Domain | 140 – 202 | 63 | t-SNARE coiled-coil homology 2 | ||||||||||||||
| Region | 1 – 75 | 75 | Interaction with CENPF | ||||||||||||||
| Compositional bias | 85 – 92 | 8 | Cys-rich | ||||||||||||||
Sites | |||||||||||||||||
| Site | 180 – 181 | 2 | Cleavage; by BONT/E By similarity | ||||||||||||||
Amino acid modifications | |||||||||||||||||
| Modified residue | 138 | 1 | Phosphothreonine; by PKC and PKA Ref.10 | ||||||||||||||
| Modified residue | 187 | 1 | Phosphoserine; by PKC Ref.10 | ||||||||||||||
| Lipidation | 85 | 1 | S-palmitoyl cysteine Ref.8 | ||||||||||||||
| Lipidation | 88 | 1 | S-palmitoyl cysteine Ref.8 | ||||||||||||||
| Lipidation | 90 | 1 | S-palmitoyl cysteine Ref.8 | ||||||||||||||
| Lipidation | 92 | 1 | S-palmitoyl cysteine Ref.8 | ||||||||||||||
Natural variations | |||||||||||||||||
| Alternative sequence | 58 – 89 | 32 | ERIEE…CGLCV → DRVEEGMNHINQDMKEAEKN LKDLGKCCGLFI in isoform SNAP-25a. | VSP_010019 | |||||||||||||
Experimental info | |||||||||||||||||
| Mutagenesis | 85 | 1 | C → S: 91% reduction in palmitoylation level. 14% membrane association. No palmitoylation and less than 8% membrane association; when associated with S-88 or A-88. Ref.8 | ||||||||||||||
| Mutagenesis | 88 | 1 | C → S: 79% reduction in palmitoylation level. 18% membrane association. No palmitoylation and less than 8% membrane association; when associated with S-85 or A-85. Ref.8 | ||||||||||||||
| Mutagenesis | 90 | 1 | C → S: 58% reduction in palmitoylation level. 28% membrane association. Very little palmitoylation and less than 8% membrane association; when associated with S-92 or A-92. Ref.8 | ||||||||||||||
| Mutagenesis | 92 | 1 | C → S: 65% reduction in palmitoylation level. 29% membrane association. No palmitoylation and less than 8% membrane association; when associated with S-90 or A-90. Ref.8 | ||||||||||||||
Secondary structure | |||||||||||||||||
Helix Strand Turn | |||||||||||||||||
| Helix | 21 – 73 | 53 | |||||||||||||||
| Turn | 74 – 76 | 3 | |||||||||||||||
| Helix | 77 – 81 | 5 | |||||||||||||||
| Turn | 140 – 143 | 4 | |||||||||||||||
| Helix | 144 – 202 | 59 | |||||||||||||||
| Turn | 203 – 205 | 3 | |||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The identification of a novel synaptosomal-associated protein, SNAP-25, differentially expressed by neuronal subpopulations." Oyler G.A., Higgins G.A., Hart R.A., Battenberg E., Billingsley M., Bloom F.E., Wilson M.C. J. Cell Biol. 109:3039-3052(1989) [PubMed: 2592413] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SNAP-25A), SUBCELLULAR LOCATION. Strain: BALB/c. |
| [2] | "High-throughput sequence identification of gene coding variants within alcohol-related QTLs." Ehringer M.A., Thompson J., Conroy O., Xu Y., Yang F., Canniff J., Beeson M., Gordon L., Bennett B., Johnson T.E., Sikela J.M. Mamm. Genome 12:657-663(2001) [PubMed: 11471062] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SNAP-25A). Strain: ILS and ISS. |
| [3] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed: 16141072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SNAP-25B). Strain: C57BL/6J. Tissue: Medulla oblongata. |
| [4] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed: 19468303] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6J. |
| [5] | Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C. Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SNAP-25A). Strain: C57BL/6. Tissue: Eye. |
| [7] | Lubec G., Kang S.U. Submitted (APR-2007) to UniProtKB Cited for: PROTEIN SEQUENCE OF 18-31; 60-72; 125-135 AND 143-176, MASS SPECTROMETRY. Strain: C57BL/6. Tissue: Brain. |
| [8] | "Characterization of the palmitoylation domain of SNAP-25." Lane S.R., Liu Y. J. Neurochem. 69:1864-1869(1997) [PubMed: 9349529] [Abstract] Cited for: PALMITOYLATION AT CYS-85; CYS-88; CYS-90 AND CYS-92, MUTAGENESIS OF CYS-85; CYS-88; CYS-90 AND CYS-92. |
| [9] | "Snapin: a SNARE-associated protein implicated in synaptic transmission." Ilardi J.M., Mochida S., Sheng Z.-H. Nat. Neurosci. 2:119-124(1999) [PubMed: 10195194] [Abstract] Cited for: INTERACTION WITH SNAP25BP. |
| [10] | "Differential phosphorylation of SNAP-25 in vivo by protein kinase C and protein kinase A." Hepp R., Cabaniols J.-P., Roche P.A. FEBS Lett. 532:52-56(2002) [PubMed: 12459461] [Abstract] Cited for: PHOSPHORYLATION AT THR-138 AND SER-187. |
| [11] | "SV2B regulates synaptotagmin 1 by direct interaction." Lazzell D.R., Belizaire R., Thakur P., Sherry D.M., Janz R. J. Biol. Chem. 279:52124-52131(2004) [PubMed: 15466855] [Abstract] Cited for: INTERACTION WITH SYT1; SV2B AND SYNTAXIN-1. |
| [12] | "Otoferlin, defective in a human deafness form, is essential for exocytosis at the auditory ribbon synapse." Roux I., Safieddine S., Nouvian R., Grati M., Simmler M.-C., Bahloul A., Perfettini I., Le Gall M., Rostaing P., Hamard G., Triller A., Avan P., Moser T., Petit C. Cell 127:277-289(2006) [PubMed: 17055430] [Abstract] Cited for: INTERACTION WITH OTOF. Strain: BALB/c. Tissue: Cochlea. |
| [13] | "CytLEK1 is a regulator of plasma membrane recycling through its interaction with SNAP-25." Pooley R.D., Reddy S., Soukoulis V., Roland J.T., Goldenring J.R., Bader D.M. Mol. Biol. Cell 17:3176-3186(2006) [PubMed: 16672379] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH CENPF. |
| [14] | "The synaptic SNARE complex is a parallel four-stranded helical bundle." Poirier M.A., Xiao W., Macosko J.C., Chan C., Shin Y.K., Bennett M.K. Nat. Struct. Biol. 5:765-769(1998) [PubMed: 9731768] [Abstract] Cited for: 3D-STRUCTURE MODELING OF 18-206 IN COMPLEX WITH VAMP2 AND STX1A. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| M22012 mRNA. Translation: AAA61741.1. AF483516 mRNA. Translation: AAL90790.1. AF483517 mRNA. Translation: AAL90791.1. AK078038 mRNA. Translation: BAC37105.1. AL732447 Genomic DNA. Translation: CAM15064.1. AL732447 Genomic DNA. Translation: CAM15065.1. CH466519 Genomic DNA. Translation: EDL28390.1. BC018249 mRNA. Translation: AAH18249.1. | |||||||||||||||||||
| IPI | IPI00125635. IPI00225389. | ||||||||||||||||||
| PIR | A33623. | ||||||||||||||||||
| RefSeq | NP_035558.1. | ||||||||||||||||||
| UniGene | Mm.45953 | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| |||||||||||||||||||
| SMR | P60879. Positions 7-83, 131-204. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| DIP | DIP:29066N. | ||||||||||||||||||
| IntAct | P60879. 7 interactions. | ||||||||||||||||||
| STRING | P60879. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | P60879. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PRIDE | P60879. | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENSMUST00000028727; ENSMUSP00000028727; ENSMUSG00000027273; Mus musculus. [Genome view] ENSMUST00000110098; ENSMUSP00000105725; ENSMUSG00000027273; Mus musculus. [Genome view] | ||||||||||||||||||
| GeneID | 20614. | ||||||||||||||||||
| KEGG | mmu:20614. | ||||||||||||||||||
| UCSC | uc008mop.1. mouse. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 20614. | ||||||||||||||||||
| MGI | MGI:98331. Snap25. | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| HOVERGEN | P60879. | ||||||||||||||||||
| OMA | LADEXSK. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | P60879. | ||||||||||||||||||
| Bgee | P60879. | ||||||||||||||||||
| CleanEx | MM_SNAP25. | ||||||||||||||||||
| Genevestigator | P60879. | ||||||||||||||||||
| GermOnline | ENSMUSG00000027273. Mus musculus. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR000928. SNAP-25. IPR000727. T_SNARE. [Graphical view] | ||||||||||||||||||
| Pfam | PF00835. SNAP-25. 1 hit. PF05739. SNARE. 1 hit. [Graphical view] | ||||||||||||||||||
| SMART | SM00397. t_SNARE. 2 hits. [Graphical view] | ||||||||||||||||||
| PROSITE | PS50192. T_SNARE. 2 hits. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other Resources | |||||||||||||||||||
| NextBio | 298983. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | SNP25_MOUSE | ||||||||
| Accession | Primary (citable) accession number: P60879 Secondary accession number(s): A2AIC2 Q9BR45 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


