Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Synaptosomal-associated protein 25

Gene

Snap25

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

t-SNARE involved in the molecular regulation of neurotransmitter release. May play an important role in the synaptic function of specific neuronal systems. Associates with proteins involved in vesicle docking and membrane fusion. Regulates plasma membrane recycling through its interaction with CENPF (PubMed:16672379). Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1 in pancreatic beta cells (By similarity).By similarity1 Publication

GO - Molecular functioni

  • calcium-dependent protein binding Source: ParkinsonsUK-UCL
  • SNAP receptor activity Source: GO_Central
  • SNARE binding Source: MGI
  • syntaxin-1 binding Source: ParkinsonsUK-UCL

GO - Biological processi

  • associative learning Source: MGI
  • exocytic insertion of neurotransmitter receptor to postsynaptic membrane Source: SynGO
  • locomotory behavior Source: MGI
  • long-term synaptic potentiation Source: MGI
  • neurotransmitter receptor internalization Source: SynGO
  • neurotransmitter secretion Source: MGI
  • positive regulation of synaptic plasticity Source: MGI
  • regulation of establishment of protein localization Source: MGI
  • regulation of neuron projection development Source: ParkinsonsUK-UCL
  • short-term synaptic potentiation Source: MGI
  • synaptic vesicle fusion to presynaptic active zone membrane Source: GO_Central
  • synaptic vesicle priming Source: GO_Central

Enzyme and pathway databases

ReactomeiR-MMU-181429 Serotonin Neurotransmitter Release Cycle
R-MMU-181430 Norepinephrine Neurotransmitter Release Cycle
R-MMU-210500 Glutamate Neurotransmitter Release Cycle
R-MMU-212676 Dopamine Neurotransmitter Release Cycle
R-MMU-264642 Acetylcholine Neurotransmitter Release Cycle
R-MMU-449836 Other interleukin signaling
R-MMU-6798695 Neutrophil degranulation
R-MMU-888590 GABA synthesis, release, reuptake and degradation

Protein family/group databases

TCDBi1.F.1.1.4 the synaptosomal vesicle fusion pore (svf-pore) family

Names & Taxonomyi

Protein namesi
Recommended name:
Synaptosomal-associated protein 25
Short name:
SNAP-25
Alternative name(s):
Super protein
Short name:
SUP
Synaptosomal-associated 25 kDa protein
Gene namesi
Name:Snap25
Synonyms:Snap
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 2

Organism-specific databases

MGIiMGI:98331 Snap25

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasm, Membrane, Synapse, Synaptosome

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi85C → S: 91% reduction in palmitoylation level. 14% membrane association. No palmitoylation and less than 8% membrane association; when associated with S-88 or A-88. 1 Publication1
Mutagenesisi88C → S: 79% reduction in palmitoylation level. 18% membrane association. No palmitoylation and less than 8% membrane association; when associated with S-85 or A-85. 1 Publication1
Mutagenesisi90C → S: 58% reduction in palmitoylation level. 28% membrane association. Very little palmitoylation and less than 8% membrane association; when associated with S-92 or A-92. 1 Publication1
Mutagenesisi92C → S: 65% reduction in palmitoylation level. 29% membrane association. No palmitoylation and less than 8% membrane association; when associated with S-90 or A-90. 1 Publication1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002135891 – 206Synaptosomal-associated protein 25Add BLAST206

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Lipidationi85S-palmitoyl cysteine1 Publication1
Lipidationi88S-palmitoyl cysteine1 Publication1
Lipidationi90S-palmitoyl cysteine1 Publication1
Lipidationi92S-palmitoyl cysteine1 Publication1
Modified residuei138Phosphothreonine; by PKC and PKACombined sources1 Publication1
Modified residuei154PhosphoserineCombined sources1
Modified residuei187Phosphoserine; by PKC1 Publication1

Post-translational modificationi

Palmitoylated. Cys-85 appears to be the main site, and palmitoylation is required for membrane association.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei180 – 181Cleavage; by BONT/EBy similarity2

Keywords - PTMi

Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

MaxQBiP60879
PaxDbiP60879
PeptideAtlasiP60879
PRIDEiP60879

PTM databases

iPTMnetiP60879
PhosphoSitePlusiP60879
SwissPalmiP60879

Expressioni

Gene expression databases

BgeeiENSMUSG00000027273
CleanExiMM_SNAP25
GenevisibleiP60879 MM

Interactioni

Subunit structurei

Part of the SNARE core complex containing SNAP25, VAMP2 and STX1A, this complex binds CPLX1 (By similarity). Found in a complex containing SYT1, SV2B and syntaxin-1 (PubMed:15466855). Found in a ternary complex with STX1A and VAMP8 (By similarity). Isoform 1 and isoform 2 interact with BLOC1S6 (PubMed:19546860). Interacts with CENPF (PubMed:16672379). Interacts with EQTN (PubMed:19285662). Interacts with HGS (By similarity). Interacts with KCNB1 (via N-terminus); reduces the voltage-dependent potassium channel KCNB1 activity in pancreatic beta cells (By similarity). Interacts with OTOF (PubMed:17055430). Interacts with RIMS1 (By similarity). Interacts with SNAPIN (PubMed:10195194). Interacts with STXBP6 (By similarity). Interacts with TRIM9 (By similarity). Interacts with ZDHHC13 (via ANK repeats) (PubMed:25253725). Interacts with ZDHHC17 (via ANK repeats) (PubMed:25253725). Associates with the BLOC-1 complex (PubMed:19546860). Interacts with HSC70 and with SYT9, forming a complex with DNAJC5 (PubMed:20847230). The interaction with SYT9 is inhibited in presence of calcium (PubMed:20847230). Interacts with PLCL1 (via C2 domain) (PubMed:23341457). Interacts with PRRT2; this interaction may impair the formation of the SNARE complex (PubMed:22832103, PubMed:27052163, PubMed:29056747).By similarity12 Publications

Binary interactionsi

Show more details

GO - Molecular functioni

  • calcium-dependent protein binding Source: ParkinsonsUK-UCL
  • SNAP receptor activity Source: GO_Central
  • SNARE binding Source: MGI
  • syntaxin-1 binding Source: ParkinsonsUK-UCL

Protein-protein interaction databases

BioGridi203362, 33 interactors
CORUMiP60879
DIPiDIP-29066N
IntActiP60879, 42 interactors
MINTiP60879
STRINGi10090.ENSMUSP00000028727

Structurei

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2BU0model-C18-82[»]
D139-206[»]
ProteinModelPortaliP60879
SMRiP60879
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini19 – 81t-SNARE coiled-coil homology 1PROSITE-ProRule annotationAdd BLAST63
Domaini140 – 202t-SNARE coiled-coil homology 2PROSITE-ProRule annotationAdd BLAST63

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 75Interaction with CENPF1 PublicationAdd BLAST75
Regioni111 – 120Interaction with ZDHHC17By similarity10

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi85 – 92Cys-rich8

Sequence similaritiesi

Belongs to the SNAP-25 family.Curated

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

eggNOGiKOG3065 Eukaryota
ENOG410Y3Y0 LUCA
GeneTreeiENSGT00390000012186
HOVERGENiHBG056971
InParanoidiP60879
KOiK18211
OMAiGEMDENL
OrthoDBiEOG091G0N7J
PhylomeDBiP60879
TreeFamiTF315125

Family and domain databases

InterProiView protein in InterPro
IPR000928 SNAP-25
IPR000727 T_SNARE_dom
PfamiView protein in Pfam
PF00835 SNAP-25, 1 hit
SMARTiView protein in SMART
SM00397 t_SNARE, 2 hits
PROSITEiView protein in PROSITE
PS50192 T_SNARE, 2 hits

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Isoforms differ by the usage of two alternative homologous exons (5a and 5b) which code for positions 56 to 94 and differ only in 9 positions out of 39.
Isoform 1 (identifier: P60879-1) [UniParc]FASTAAdd to basket
Also known as: SNAP-25b

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAEDADMRNE LEEMQRRADQ LADESLESTR RMLQLVEESK DAGIRTLVML
60 70 80 90 100
DEQGEQLERI EEGMDQINKD MKEAEKNLTD LGKFCGLCVC PCNKLKSSDA
110 120 130 140 150
YKKAWGNNQD GVVASQPARV VDEREQMAIS GGFIRRVTND ARENEMDENL
160 170 180 190 200
EQVSGIIGNL RHMALDMGNE IDTQNRQIDR IMEKADSNKT RIDEANQRAT

KMLGSG
Length:206
Mass (Da):23,315
Last modified:April 13, 2004 - v1
Checksum:iFBED2B082A4CB6A6
GO
Isoform 2 (identifier: P60879-2) [UniParc] [UniParc]FASTAAdd to basket
Also known as: SNAP-25a

The sequence of this isoform differs from the canonical sequence as follows:
     58-89: ERIEEGMDQINKDMKEAEKNLTDLGKFCGLCV → DRVEEGMNHINQDMKEAEKNLKDLGKCCGLFI

Show »
Length:206
Mass (Da):23,336
Checksum:iE272652C701EA984
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_01001958 – 89ERIEE…CGLCV → DRVEEGMNHINQDMKEAEKN LKDLGKCCGLFI in isoform 2. 3 PublicationsAdd BLAST32

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M22012 mRNA Translation: AAA61741.1
AF483516 mRNA Translation: AAL90790.1
AF483517 mRNA Translation: AAL90791.1
AK078038 mRNA Translation: BAC37105.1
AL732447 Genomic DNA Translation: CAM15064.1
AL732447 Genomic DNA Translation: CAM15065.1
CH466519 Genomic DNA Translation: EDL28390.1
BC018249 mRNA Translation: AAH18249.1
CCDSiCCDS16793.1
CCDS71153.1 [P60879-2]
PIRiA33623
RefSeqiNP_001277985.1, NM_001291056.1 [P60879-2]
NP_035558.1, NM_011428.3 [P60879-1]
XP_017172247.1, XM_017316758.1
XP_017172249.1, XM_017316760.1 [P60879-2]
UniGeneiMm.45953

Genome annotation databases

EnsembliENSMUST00000028727; ENSMUSP00000028727; ENSMUSG00000027273 [P60879-1]
ENSMUST00000110098; ENSMUSP00000105725; ENSMUSG00000027273 [P60879-2]
GeneIDi20614
KEGGimmu:20614
UCSCiuc008mop.1 mouse
uc056zpt.1 mouse [P60879-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiSNP25_MOUSE
AccessioniPrimary (citable) accession number: P60879
Secondary accession number(s): A2AIC2
, A2AIC3, P13795, P36974, P70557, P70558, Q8IXK3, Q96FM2, Q9BR45
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 13, 2004
Last sequence update: April 13, 2004
Last modified: April 25, 2018
This is version 150 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health