Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P59780

- AP3S2_HUMAN

UniProt

P59780 - AP3S2_HUMAN

Protein

AP-3 complex subunit sigma-2

Gene

AP3S2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 100 (01 Oct 2014)
      Sequence version 1 (19 Jul 2003)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Part of the AP-3 complex, an adaptor-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes. In concert with the BLOC-1 complex, AP-3 is required to target cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals.

    GO - Molecular functioni

    1. protein transporter activity Source: InterPro

    GO - Biological processi

    1. anterograde axon cargo transport Source: UniProtKB
    2. anterograde synaptic vesicle transport Source: UniProtKB
    3. intracellular protein transport Source: ProtInc

    Keywords - Biological processi

    Protein transport, Transport

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    AP-3 complex subunit sigma-2
    Alternative name(s):
    AP-3 complex subunit sigma-3B
    Adaptor-related protein complex 3 subunit sigma-2
    Sigma-3B-adaptin
    Short name:
    Sigma3B-adaptin
    Sigma-adaptin 3b
    Gene namesi
    Name:AP3S2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 15

    Organism-specific databases

    HGNCiHGNC:571. AP3S2.

    Subcellular locationi

    Golgi apparatus. Cytoplasmic vesicle membrane By similarity; Peripheral membrane protein By similarity; Cytoplasmic side By similarity
    Note: Component of the coat surrounding the cytoplasmic face of coated vesicles located at the Golgi complex.By similarity

    GO - Cellular componenti

    1. AP-3 adaptor complex Source: FlyBase
    2. cytoplasmic vesicle membrane Source: UniProtKB-SubCell
    3. Golgi apparatus Source: ProtInc

    Keywords - Cellular componenti

    Cytoplasmic vesicle, Golgi apparatus, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA24863.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 193193AP-3 complex subunit sigma-2PRO_0000193817Add
    BLAST

    Proteomic databases

    MaxQBiP59780.
    PaxDbiP59780.
    PRIDEiP59780.

    PTM databases

    PhosphoSiteiP59780.

    Expressioni

    Tissue specificityi

    Present in all adult tissues examined.1 Publication

    Gene expression databases

    ArrayExpressiP59780.
    BgeeiP59780.
    CleanExiHS_AP3S2.
    GenevestigatoriP59780.

    Organism-specific databases

    HPAiHPA049270.
    HPA050067.

    Interactioni

    Subunit structurei

    Adaptor protein complex 3 (AP-3) is a heterotetramer composed of two large adaptins (delta-type subunit AP3D1 and beta-type subunit AP3B1 or AP3B2), a medium adaptin (mu-type subunit AP3M1 or AP3M2) and a small adaptin (sigma-type subunit APS1 or AP3S2). Interacts with AGAP1. AP-3 associates with the BLOC-1 complex By similarity.By similarity

    Protein-protein interaction databases

    BioGridi115533. 7 interactions.
    IntActiP59780. 1 interaction.
    STRINGi9606.ENSP00000338777.

    Structurei

    3D structure databases

    ProteinModelPortaliP59780.
    SMRiP59780. Positions 1-148.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Phylogenomic databases

    eggNOGiCOG5030.
    HOGENOMiHOG000185228.
    HOVERGENiHBG050517.
    InParanoidiP59780.
    KOiK12399.
    OrthoDBiEOG7W41CZ.
    PhylomeDBiP59780.
    TreeFamiTF300189.

    Family and domain databases

    InterProiIPR016635. AP_complex_ssu.
    IPR022775. AP_mu_sigma_su.
    IPR000804. Clathrin_sm-chain_CS.
    IPR011012. Longin-like_dom.
    [Graphical view]
    PANTHERiPTHR11753. PTHR11753. 1 hit.
    PfamiPF01217. Clat_adaptor_s. 1 hit.
    [Graphical view]
    PIRSFiPIRSF015588. AP_complex_sigma. 1 hit.
    SUPFAMiSSF64356. SSF64356. 1 hit.
    PROSITEiPS00989. CLAT_ADAPTOR_S. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P59780-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MIQAILVFNN HGKPRLVRFY QRFPEEIQQQ IVRETFHLVL KRDDNICNFL    50
    EGGSLIGGSD YKLIYRHYAT LYFVFCVDSS ESELGILDLI QVFVETLDKC 100
    FENVCELDLI FHMDKVHYIL QEVVMGGMVL ETNMNEIVAQ IEAQNRLEKS 150
    EGGLSAAPAR AVSAVKNINL PEIPRNINIG DLNIKVPNLS QFV 193
    Length:193
    Mass (Da):22,017
    Last modified:July 19, 2003 - v1
    Checksum:iD219EF4A989316EA
    GO
    Isoform C15orf38-AP3S2 (identifier: Q7Z6K5-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform can be found in the external entry Q7Z6K5.
    Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.

    Note: Based on a naturally occurring readthrough transcript which produces a C15orf38-AP3S2 fusion protein.

    Length:394
    Mass (Da):43,882
    GO
    Isoform 3 (identifier: P59780-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         92-124: VFVETLDKCFENVCELDLIFHMDKVHYILQEVV → LKKRERKKSQCNTLQTGTLALWEQGPDIRTRRL
         125-193: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:124
    Mass (Da):14,592
    Checksum:i98788985D4597692
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti84 – 841L → I in BAG35374. (PubMed:14702039)Curated
    Sequence conflicti127 – 1271G → W in BAD96418. 1 PublicationCurated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei92 – 12433VFVET…LQEVV → LKKRERKKSQCNTLQTGTLA LWEQGPDIRTRRL in isoform 3. 1 PublicationVSP_053673Add
    BLAST
    Alternative sequencei125 – 19369Missing in isoform 3. 1 PublicationVSP_053674Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X99459 mRNA. Translation: CAA67824.1.
    AK294712 mRNA. Translation: BAG57864.1.
    AK312467 mRNA. Translation: BAG35374.1.
    AK222698 mRNA. Translation: BAD96418.1.
    AC018988 Genomic DNA. No translation available.
    AC027176 Genomic DNA. No translation available.
    CH471101 Genomic DNA. Translation: EAX02074.1.
    BC002785 mRNA. Translation: AAH02785.1.
    BC010020 mRNA. Translation: AAH10020.1.
    CCDSiCCDS10357.1. [P59780-1]
    RefSeqiNP_005820.1. NM_005829.4. [P59780-1]
    UniGeneiHs.632161.

    Genome annotation databases

    EnsembliENST00000336418; ENSP00000338777; ENSG00000157823. [P59780-1]
    ENST00000423566; ENSP00000394170; ENSG00000157823. [P59780-2]
    ENST00000560251; ENSP00000453288; ENSG00000157823. [P59780-2]
    GeneIDi10239.
    KEGGihsa:10239.
    UCSCiuc002boq.4. human. [P59780-1]

    Polymorphism databases

    DMDMi33112220.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X99459 mRNA. Translation: CAA67824.1 .
    AK294712 mRNA. Translation: BAG57864.1 .
    AK312467 mRNA. Translation: BAG35374.1 .
    AK222698 mRNA. Translation: BAD96418.1 .
    AC018988 Genomic DNA. No translation available.
    AC027176 Genomic DNA. No translation available.
    CH471101 Genomic DNA. Translation: EAX02074.1 .
    BC002785 mRNA. Translation: AAH02785.1 .
    BC010020 mRNA. Translation: AAH10020.1 .
    CCDSi CCDS10357.1. [P59780-1 ]
    RefSeqi NP_005820.1. NM_005829.4. [P59780-1 ]
    UniGenei Hs.632161.

    3D structure databases

    ProteinModelPortali P59780.
    SMRi P59780. Positions 1-148.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 115533. 7 interactions.
    IntActi P59780. 1 interaction.
    STRINGi 9606.ENSP00000338777.

    PTM databases

    PhosphoSitei P59780.

    Polymorphism databases

    DMDMi 33112220.

    Proteomic databases

    MaxQBi P59780.
    PaxDbi P59780.
    PRIDEi P59780.

    Protocols and materials databases

    DNASUi 10239.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000336418 ; ENSP00000338777 ; ENSG00000157823 . [P59780-1 ]
    ENST00000423566 ; ENSP00000394170 ; ENSG00000157823 . [P59780-2 ]
    ENST00000560251 ; ENSP00000453288 ; ENSG00000157823 . [P59780-2 ]
    GeneIDi 10239.
    KEGGi hsa:10239.
    UCSCi uc002boq.4. human. [P59780-1 ]

    Organism-specific databases

    CTDi 10239.
    GeneCardsi GC15M090373.
    HGNCi HGNC:571. AP3S2.
    HPAi HPA049270.
    HPA050067.
    MIMi 602416. gene.
    neXtProti NX_P59780.
    PharmGKBi PA24863.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5030.
    HOGENOMi HOG000185228.
    HOVERGENi HBG050517.
    InParanoidi P59780.
    KOi K12399.
    OrthoDBi EOG7W41CZ.
    PhylomeDBi P59780.
    TreeFami TF300189.

    Miscellaneous databases

    ChiTaRSi AP3S2. human.
    GeneWikii AP3S2.
    GenomeRNAii 10239.
    NextBioi 35467555.
    PROi P59780.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P59780.
    Bgeei P59780.
    CleanExi HS_AP3S2.
    Genevestigatori P59780.

    Family and domain databases

    InterProi IPR016635. AP_complex_ssu.
    IPR022775. AP_mu_sigma_su.
    IPR000804. Clathrin_sm-chain_CS.
    IPR011012. Longin-like_dom.
    [Graphical view ]
    PANTHERi PTHR11753. PTHR11753. 1 hit.
    Pfami PF01217. Clat_adaptor_s. 1 hit.
    [Graphical view ]
    PIRSFi PIRSF015588. AP_complex_sigma. 1 hit.
    SUPFAMi SSF64356. SSF64356. 1 hit.
    PROSITEi PS00989. CLAT_ADAPTOR_S. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "AP-3: an adaptor-like protein complex with ubiquitous expression."
      Dell'Angelica E.C., Ohno H., Ooi C.E., Rabinovich E., Roche K.W., Bonifacino J.S.
      EMBO J. 16:917-928(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
      Tissue: Brain.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
      Tissue: Hippocampus.
    3. Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
      Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
      Tissue: Brain.
    4. "Analysis of the DNA sequence and duplication history of human chromosome 15."
      Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A.
      , Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.
      Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Colon and Skin.
    7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiAP3S2_HUMAN
    AccessioniPrimary (citable) accession number: P59780
    Secondary accession number(s): B2R677
    , B4DGQ3, O09077, O09149, Q53H83, Q99589
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 19, 2003
    Last sequence update: July 19, 2003
    Last modified: October 1, 2014
    This is version 100 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 15
      Human chromosome 15: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3