Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

AP-3 complex subunit sigma-2

Gene

AP3S2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Part of the AP-3 complex, an adaptor-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes. In concert with the BLOC-1 complex, AP-3 is required to target cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals.

GO - Molecular functioni

  1. protein transporter activity Source: InterPro

GO - Biological processi

  1. anterograde axon cargo transport Source: UniProtKB
  2. anterograde synaptic vesicle transport Source: UniProtKB
  3. intracellular protein transport Source: ProtInc
Complete GO annotation...

Keywords - Biological processi

Protein transport, Transport

Names & Taxonomyi

Protein namesi
Recommended name:
AP-3 complex subunit sigma-2
Alternative name(s):
AP-3 complex subunit sigma-3B
Adaptor-related protein complex 3 subunit sigma-2
Sigma-3B-adaptin
Short name:
Sigma3B-adaptin
Sigma-adaptin 3b
Gene namesi
Name:AP3S2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 15

Organism-specific databases

HGNCiHGNC:571. AP3S2.

Subcellular locationi

  1. Golgi apparatus
  2. Cytoplasmic vesicle membrane By similarity; Peripheral membrane protein By similarity; Cytoplasmic side By similarity

  3. Note: Component of the coat surrounding the cytoplasmic face of coated vesicles located at the Golgi complex.By similarity

GO - Cellular componenti

  1. AP-3 adaptor complex Source: FlyBase
  2. cytoplasmic vesicle membrane Source: UniProtKB-SubCell
  3. Golgi apparatus Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasmic vesicle, Golgi apparatus, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA24863.

Polymorphism and mutation databases

BioMutaiAP3S2.
DMDMi33112220.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 193193AP-3 complex subunit sigma-2PRO_0000193817Add
BLAST

Proteomic databases

MaxQBiP59780.
PaxDbiP59780.
PRIDEiP59780.

PTM databases

PhosphoSiteiP59780.

Expressioni

Tissue specificityi

Present in all adult tissues examined.1 Publication

Gene expression databases

BgeeiP59780.
CleanExiHS_AP3S2.
ExpressionAtlasiP59780. baseline and differential.
GenevestigatoriP59780.

Organism-specific databases

HPAiHPA049270.
HPA050067.

Interactioni

Subunit structurei

Adaptor protein complex 3 (AP-3) is a heterotetramer composed of two large adaptins (delta-type subunit AP3D1 and beta-type subunit AP3B1 or AP3B2), a medium adaptin (mu-type subunit AP3M1 or AP3M2) and a small adaptin (sigma-type subunit APS1 or AP3S2). Interacts with AGAP1. AP-3 associates with the BLOC-1 complex (By similarity).By similarity

Protein-protein interaction databases

BioGridi115533. 10 interactions.
IntActiP59780. 1 interaction.
STRINGi9606.ENSP00000338777.

Structurei

3D structure databases

ProteinModelPortaliP59780.
SMRiP59780. Positions 1-148.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiCOG5030.
GeneTreeiENSGT00550000074761.
HOGENOMiHOG000185228.
HOVERGENiHBG050517.
InParanoidiP59780.
KOiK12399.
OrthoDBiEOG7W41CZ.
PhylomeDBiP59780.
TreeFamiTF300189.

Family and domain databases

InterProiIPR016635. AP_complex_ssu.
IPR022775. AP_mu_sigma_su.
IPR000804. Clathrin_sm-chain_CS.
IPR011012. Longin-like_dom.
[Graphical view]
PANTHERiPTHR11753. PTHR11753. 1 hit.
PfamiPF01217. Clat_adaptor_s. 1 hit.
[Graphical view]
SUPFAMiSSF64356. SSF64356. 1 hit.
PROSITEiPS00989. CLAT_ADAPTOR_S. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P59780-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MIQAILVFNN HGKPRLVRFY QRFPEEIQQQ IVRETFHLVL KRDDNICNFL
60 70 80 90 100
EGGSLIGGSD YKLIYRHYAT LYFVFCVDSS ESELGILDLI QVFVETLDKC
110 120 130 140 150
FENVCELDLI FHMDKVHYIL QEVVMGGMVL ETNMNEIVAQ IEAQNRLEKS
160 170 180 190
EGGLSAAPAR AVSAVKNINL PEIPRNINIG DLNIKVPNLS QFV
Length:193
Mass (Da):22,017
Last modified:July 19, 2003 - v1
Checksum:iD219EF4A989316EA
GO
Isoform C15orf38-AP3S2 (identifier: Q7Z6K5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform can be found in the external entry Q7Z6K5.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.

Note: Based on a naturally occurring readthrough transcript which produces a C15orf38-AP3S2 fusion protein.

Length:394
Mass (Da):43,882
GO
Isoform 3 (identifier: P59780-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     92-124: VFVETLDKCFENVCELDLIFHMDKVHYILQEVV → LKKRERKKSQCNTLQTGTLALWEQGPDIRTRRL
     125-193: Missing.

Note: No experimental confirmation available.

Show »
Length:124
Mass (Da):14,592
Checksum:i98788985D4597692
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti84 – 841L → I in BAG35374 (PubMed:14702039).Curated
Sequence conflicti127 – 1271G → W in BAD96418 (Ref. 3) Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei92 – 12433VFVET…LQEVV → LKKRERKKSQCNTLQTGTLA LWEQGPDIRTRRL in isoform 3. 1 PublicationVSP_053673Add
BLAST
Alternative sequencei125 – 19369Missing in isoform 3. 1 PublicationVSP_053674Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X99459 mRNA. Translation: CAA67824.1.
AK294712 mRNA. Translation: BAG57864.1.
AK312467 mRNA. Translation: BAG35374.1.
AK222698 mRNA. Translation: BAD96418.1.
AC018988 Genomic DNA. No translation available.
AC027176 Genomic DNA. No translation available.
CH471101 Genomic DNA. Translation: EAX02074.1.
BC002785 mRNA. Translation: AAH02785.1.
BC010020 mRNA. Translation: AAH10020.1.
CCDSiCCDS10357.1. [P59780-1]
RefSeqiNP_005820.1. NM_005829.4. [P59780-1]
UniGeneiHs.632161.

Genome annotation databases

EnsembliENST00000336418; ENSP00000338777; ENSG00000157823. [P59780-1]
ENST00000423566; ENSP00000394170; ENSG00000157823. [P59780-2]
ENST00000560251; ENSP00000453288; ENSG00000157823. [P59780-2]
GeneIDi10239.
KEGGihsa:10239.
UCSCiuc002boq.4. human. [P59780-1]

Polymorphism and mutation databases

BioMutaiAP3S2.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X99459 mRNA. Translation: CAA67824.1.
AK294712 mRNA. Translation: BAG57864.1.
AK312467 mRNA. Translation: BAG35374.1.
AK222698 mRNA. Translation: BAD96418.1.
AC018988 Genomic DNA. No translation available.
AC027176 Genomic DNA. No translation available.
CH471101 Genomic DNA. Translation: EAX02074.1.
BC002785 mRNA. Translation: AAH02785.1.
BC010020 mRNA. Translation: AAH10020.1.
CCDSiCCDS10357.1. [P59780-1]
RefSeqiNP_005820.1. NM_005829.4. [P59780-1]
UniGeneiHs.632161.

3D structure databases

ProteinModelPortaliP59780.
SMRiP59780. Positions 1-148.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115533. 10 interactions.
IntActiP59780. 1 interaction.
STRINGi9606.ENSP00000338777.

PTM databases

PhosphoSiteiP59780.

Polymorphism and mutation databases

BioMutaiAP3S2.
DMDMi33112220.

Proteomic databases

MaxQBiP59780.
PaxDbiP59780.
PRIDEiP59780.

Protocols and materials databases

DNASUi10239.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000336418; ENSP00000338777; ENSG00000157823. [P59780-1]
ENST00000423566; ENSP00000394170; ENSG00000157823. [P59780-2]
ENST00000560251; ENSP00000453288; ENSG00000157823. [P59780-2]
GeneIDi10239.
KEGGihsa:10239.
UCSCiuc002boq.4. human. [P59780-1]

Organism-specific databases

CTDi10239.
GeneCardsiGC15M090373.
HGNCiHGNC:571. AP3S2.
HPAiHPA049270.
HPA050067.
MIMi602416. gene.
neXtProtiNX_P59780.
PharmGKBiPA24863.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiCOG5030.
GeneTreeiENSGT00550000074761.
HOGENOMiHOG000185228.
HOVERGENiHBG050517.
InParanoidiP59780.
KOiK12399.
OrthoDBiEOG7W41CZ.
PhylomeDBiP59780.
TreeFamiTF300189.

Miscellaneous databases

ChiTaRSiAP3S2. human.
GeneWikiiAP3S2.
GenomeRNAii10239.
NextBioi35467555.
PROiP59780.
SOURCEiSearch...

Gene expression databases

BgeeiP59780.
CleanExiHS_AP3S2.
ExpressionAtlasiP59780. baseline and differential.
GenevestigatoriP59780.

Family and domain databases

InterProiIPR016635. AP_complex_ssu.
IPR022775. AP_mu_sigma_su.
IPR000804. Clathrin_sm-chain_CS.
IPR011012. Longin-like_dom.
[Graphical view]
PANTHERiPTHR11753. PTHR11753. 1 hit.
PfamiPF01217. Clat_adaptor_s. 1 hit.
[Graphical view]
SUPFAMiSSF64356. SSF64356. 1 hit.
PROSITEiPS00989. CLAT_ADAPTOR_S. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "AP-3: an adaptor-like protein complex with ubiquitous expression."
    Dell'Angelica E.C., Ohno H., Ooi C.E., Rabinovich E., Roche K.W., Bonifacino J.S.
    EMBO J. 16:917-928(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
    Tissue: Brain.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
    Tissue: Hippocampus.
  3. Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
    Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
    Tissue: Brain.
  4. "Analysis of the DNA sequence and duplication history of human chromosome 15."
    Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A.
    , Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.
    Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Colon and Skin.
  7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiAP3S2_HUMAN
AccessioniPrimary (citable) accession number: P59780
Secondary accession number(s): B2R677
, B4DGQ3, O09077, O09149, Q53H83, Q99589
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 19, 2003
Last sequence update: July 19, 2003
Last modified: April 29, 2015
This is version 104 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.