Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

AP-3 complex subunit sigma-2

Gene

AP3S2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Part of the AP-3 complex, an adaptor-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes. In concert with the BLOC-1 complex, AP-3 is required to target cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals.

GO - Biological processi

Keywordsi

Biological processProtein transport, Transport

Names & Taxonomyi

Protein namesi
Recommended name:
AP-3 complex subunit sigma-2
Alternative name(s):
AP-3 complex subunit sigma-3B
Adaptor-related protein complex 3 subunit sigma-2
Sigma-3B-adaptin
Short name:
Sigma3B-adaptin
Sigma-adaptin 3b
Gene namesi
Name:AP3S2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 15

Organism-specific databases

EuPathDBiHostDB:ENSG00000157823.16
HGNCiHGNC:571 AP3S2
MIMi602416 gene
neXtProtiNX_P59780

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasmic vesicle, Golgi apparatus, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi10239
OpenTargetsiENSG00000157823
PharmGKBiPA24863

Polymorphism and mutation databases

BioMutaiAP3S2
DMDMi33112220

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001938171 – 193AP-3 complex subunit sigma-2Add BLAST193

Proteomic databases

MaxQBiP59780
PaxDbiP59780
PeptideAtlasiP59780
PRIDEiP59780

PTM databases

iPTMnetiP59780
PhosphoSitePlusiP59780

Expressioni

Tissue specificityi

Present in all adult tissues examined.1 Publication

Gene expression databases

BgeeiENSG00000157823
CleanExiHS_AP3S2
ExpressionAtlasiP59780 baseline and differential
GenevisibleiP59780 HS

Organism-specific databases

HPAiHPA049270

Interactioni

Subunit structurei

Adaptor protein complex 3 (AP-3) is a heterotetramer composed of two large adaptins (delta-type subunit AP3D1 and beta-type subunit AP3B1 or AP3B2), a medium adaptin (mu-type subunit AP3M1 or AP3M2) and a small adaptin (sigma-type subunit APS1 or AP3S2). Interacts with AGAP1. AP-3 associates with the BLOC-1 complex (By similarity).By similarity

Protein-protein interaction databases

BioGridi115533, 13 interactors
CORUMiP59780
IntActiP59780, 2 interactors
STRINGi9606.ENSP00000338777

Structurei

3D structure databases

ProteinModelPortaliP59780
SMRiP59780
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG0936 Eukaryota
COG5030 LUCA
GeneTreeiENSGT00550000074761
HOGENOMiHOG000185228
HOVERGENiHBG050517
InParanoidiP59780
KOiK12399
PhylomeDBiP59780
TreeFamiTF300189

Family and domain databases

InterProiView protein in InterPro
IPR016635 AP_complex_ssu
IPR022775 AP_mu_sigma_su
IPR000804 Clathrin_sm-chain_CS
IPR011012 Longin-like_dom_sf
PANTHERiPTHR11753 PTHR11753, 1 hit
PfamiView protein in Pfam
PF01217 Clat_adaptor_s, 1 hit
SUPFAMiSSF64356 SSF64356, 1 hit
PROSITEiView protein in PROSITE
PS00989 CLAT_ADAPTOR_S, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P59780-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MIQAILVFNN HGKPRLVRFY QRFPEEIQQQ IVRETFHLVL KRDDNICNFL
60 70 80 90 100
EGGSLIGGSD YKLIYRHYAT LYFVFCVDSS ESELGILDLI QVFVETLDKC
110 120 130 140 150
FENVCELDLI FHMDKVHYIL QEVVMGGMVL ETNMNEIVAQ IEAQNRLEKS
160 170 180 190
EGGLSAAPAR AVSAVKNINL PEIPRNINIG DLNIKVPNLS QFV
Length:193
Mass (Da):22,017
Last modified:July 19, 2003 - v1
Checksum:iD219EF4A989316EA
GO
Isoform C15orf38-AP3S2 (identifier: Q7Z6K5-2) [UniParc]FASTAAdd to basket
The sequence of this isoform can be found in the external entry Q7Z6K5.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Note: Based on a naturally occurring readthrough transcript which produces a C15orf38-AP3S2 fusion protein.
Length:394
Mass (Da):43,882
GO
Isoform 3 (identifier: P59780-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     92-124: VFVETLDKCFENVCELDLIFHMDKVHYILQEVV → LKKRERKKSQCNTLQTGTLALWEQGPDIRTRRL
     125-193: Missing.

Note: No experimental confirmation available.
Show »
Length:124
Mass (Da):14,592
Checksum:i98788985D4597692
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti84L → I in BAG35374 (PubMed:14702039).Curated1
Sequence conflicti127G → W in BAD96418 (Ref. 3) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_05367392 – 124VFVET…LQEVV → LKKRERKKSQCNTLQTGTLA LWEQGPDIRTRRL in isoform 3. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_053674125 – 193Missing in isoform 3. 1 PublicationAdd BLAST69

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X99459 mRNA Translation: CAA67824.1
AK294712 mRNA Translation: BAG57864.1
AK312467 mRNA Translation: BAG35374.1
AK222698 mRNA Translation: BAD96418.1
AC018988 Genomic DNA No translation available.
AC027176 Genomic DNA No translation available.
CH471101 Genomic DNA Translation: EAX02074.1
BC002785 mRNA Translation: AAH02785.1
BC010020 mRNA Translation: AAH10020.1
CCDSiCCDS10357.1 [P59780-1]
RefSeqiNP_005820.1, NM_005829.4 [P59780-1]
UniGeneiHs.632161

Genome annotation databases

EnsembliENST00000336418; ENSP00000338777; ENSG00000157823 [P59780-1]
ENST00000423566; ENSP00000394170; ENSG00000157823 [P59780-2]
ENST00000560251; ENSP00000453288; ENSG00000157823 [P59780-2]
GeneIDi10239
KEGGihsa:10239
UCSCiuc002boq.5 human [P59780-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiAP3S2_HUMAN
AccessioniPrimary (citable) accession number: P59780
Secondary accession number(s): B2R677
, B4DGQ3, O09077, O09149, Q53H83, Q99589
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 19, 2003
Last sequence update: July 19, 2003
Last modified: May 23, 2018
This is version 125 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health