Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P59780 (AP3S2_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 98. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
AP-3 complex subunit sigma-2
Alternative name(s):
AP-3 complex subunit sigma-3B
Adapter-related protein complex 3 subunit sigma-2
Sigma-3B-adaptin
Short name=Sigma3B-adaptin
Sigma-adaptin 3b
Gene names
Name:AP3S2
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length193 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Part of the AP-3 complex, an adapter-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes. In concert with the BLOC-1 complex, AP-3 is required to target cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals.

Subunit structure

Adaptor protein complex 3 (AP-3) is a heterotetramer composed of two large adaptins (delta-type subunit AP3D1 and beta-type subunit AP3B1 or AP3B2), a medium adaptin (mu-type subunit AP3M1 or AP3M2) and a small adaptin (sigma-type subunit APS1 or AP3S2). Interacts with AGAP1. AP-3 associates with the BLOC-1 complex By similarity.

Subcellular location

Golgi apparatus. Cytoplasmic vesicle membrane; Peripheral membrane protein; Cytoplasmic side By similarity. Note: Component of the coat surrounding the cytoplasmic face of coated vesicles located at the Golgi complex By similarity.

Tissue specificity

Present in all adult tissues examined. Ref.1

Sequence similarities

Belongs to the adaptor complexes small subunit family.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: P59780-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform C15orf38-AP3S2 (identifier: Q7Z6K5-2)

The sequence of this isoform can be found in the external entry Q7Z6K5.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Note: Based on a naturally occurring readthrough transcript which produces a C15orf38-AP3S2 fusion protein.
Isoform 3 (identifier: P59780-2)

The sequence of this isoform differs from the canonical sequence as follows:
     92-124: VFVETLDKCFENVCELDLIFHMDKVHYILQEVV → LKKRERKKSQCNTLQTGTLALWEQGPDIRTRRL
     125-193: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 193193AP-3 complex subunit sigma-2
PRO_0000193817

Natural variations

Alternative sequence92 – 12433VFVET…LQEVV → LKKRERKKSQCNTLQTGTLA LWEQGPDIRTRRL in isoform 3.
VSP_053673
Alternative sequence125 – 19369Missing in isoform 3.
VSP_053674

Experimental info

Sequence conflict841L → I in BAG35374. Ref.2
Sequence conflict1271G → W in BAD96418. Ref.3

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified July 19, 2003. Version 1.
Checksum: D219EF4A989316EA

FASTA19322,017
        10         20         30         40         50         60 
MIQAILVFNN HGKPRLVRFY QRFPEEIQQQ IVRETFHLVL KRDDNICNFL EGGSLIGGSD 

        70         80         90        100        110        120 
YKLIYRHYAT LYFVFCVDSS ESELGILDLI QVFVETLDKC FENVCELDLI FHMDKVHYIL 

       130        140        150        160        170        180 
QEVVMGGMVL ETNMNEIVAQ IEAQNRLEKS EGGLSAAPAR AVSAVKNINL PEIPRNINIG 

       190 
DLNIKVPNLS QFV 

« Hide

Isoform C15orf38-AP3S2 [UniParc].

See Q7Z6K5.

Isoform 3 [UniParc].

Checksum: 98788985D4597692
Show »

FASTA12414,592

References

« Hide 'large scale' references
[1]"AP-3: an adaptor-like protein complex with ubiquitous expression."
Dell'Angelica E.C., Ohno H., Ooi C.E., Rabinovich E., Roche K.W., Bonifacino J.S.
EMBO J. 16:917-928(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
Tissue: Brain.
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
Tissue: Hippocampus.
[3]Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
Tissue: Brain.
[4]"Analysis of the DNA sequence and duplication history of human chromosome 15."
Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A. expand/collapse author list , Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.
Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Colon and Skin.
[7]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
X99459 mRNA. Translation: CAA67824.1.
AK294712 mRNA. Translation: BAG57864.1.
AK312467 mRNA. Translation: BAG35374.1.
AK222698 mRNA. Translation: BAD96418.1.
AC018988 Genomic DNA. No translation available.
AC027176 Genomic DNA. No translation available.
CH471101 Genomic DNA. Translation: EAX02074.1.
BC002785 mRNA. Translation: AAH02785.1.
BC010020 mRNA. Translation: AAH10020.1.
CCDSCCDS10357.1. [P59780-1]
RefSeqNP_005820.1. NM_005829.4. [P59780-1]
UniGeneHs.632161.

3D structure databases

ProteinModelPortalP59780.
SMRP59780. Positions 1-148.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid115533. 7 interactions.
IntActP59780. 1 interaction.
STRING9606.ENSP00000338777.

PTM databases

PhosphoSiteP59780.

Polymorphism databases

DMDM33112220.

Proteomic databases

MaxQBP59780.
PaxDbP59780.
PRIDEP59780.

Protocols and materials databases

DNASU10239.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000336418; ENSP00000338777; ENSG00000157823. [P59780-1]
ENST00000423566; ENSP00000394170; ENSG00000157823. [P59780-2]
ENST00000560251; ENSP00000453288; ENSG00000157823. [P59780-2]
GeneID10239.
KEGGhsa:10239.
UCSCuc002boq.4. human. [P59780-1]

Organism-specific databases

CTD10239.
GeneCardsGC15M090373.
HGNCHGNC:571. AP3S2.
HPAHPA049270.
HPA050067.
MIM602416. gene.
neXtProtNX_P59780.
PharmGKBPA24863.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG5030.
HOGENOMHOG000185228.
HOVERGENHBG050517.
InParanoidP59780.
KOK12399.
OrthoDBEOG7W41CZ.
PhylomeDBP59780.
TreeFamTF300189.

Gene expression databases

ArrayExpressP59780.
BgeeP59780.
CleanExHS_AP3S2.
GenevestigatorP59780.

Family and domain databases

InterProIPR016635. AP_complex_ssu.
IPR022775. AP_mu_sigma_su.
IPR000804. Clathrin_sm-chain_CS.
IPR011012. Longin-like_dom.
[Graphical view]
PANTHERPTHR11753. PTHR11753. 1 hit.
PfamPF01217. Clat_adaptor_s. 1 hit.
[Graphical view]
PIRSFPIRSF015588. AP_complex_sigma. 1 hit.
SUPFAMSSF64356. SSF64356. 1 hit.
PROSITEPS00989. CLAT_ADAPTOR_S. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSAP3S2. human.
GeneWikiAP3S2.
GenomeRNAi10239.
NextBio35467555.
PROP59780.
SOURCESearch...

Entry information

Entry nameAP3S2_HUMAN
AccessionPrimary (citable) accession number: P59780
Secondary accession number(s): B2R677 expand/collapse secondary AC list , B4DGQ3, O09077, O09149, Q53H83, Q99589
Entry history
Integrated into UniProtKB/Swiss-Prot: July 19, 2003
Last sequence update: July 19, 2003
Last modified: July 9, 2014
This is version 98 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 15

Human chromosome 15: entries, gene names and cross-references to MIM