SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P59103

- DAOA_HUMAN

UniProt

P59103 - DAOA_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

D-amino acid oxidase activator

Gene
DAOA, G72
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Seems to activate D-amino acid oxidase.

GO - Molecular functioni

  1. enzyme activator activity Source: UniProtKB
  2. enzyme binding Source: UniProtKB

GO - Biological processi

  1. negative regulation of D-amino-acid oxidase activity Source: UniProtKB
  2. positive regulation of catalytic activity Source: UniProtKB
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
D-amino acid oxidase activator
Alternative name(s):
Protein G72
Gene namesi
Name:DAOA
Synonyms:G72
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 13

Organism-specific databases

HGNCiHGNC:21191. DAOA.

Subcellular locationi

GO - Cellular componenti

  1. Golgi apparatus Source: UniProtKB
  2. mitochondrion Source: UniProtKB
  3. perinuclear region of cytoplasm Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Golgi apparatus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134924986.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 153153D-amino acid oxidase activatorPRO_0000079781Add
BLAST

Proteomic databases

PaxDbiP59103.
PRIDEiP59103.

Expressioni

Tissue specificityi

Expressed in amygdala, caudate nucleus, spinal cord and testis.

Gene expression databases

ArrayExpressiP59103.
CleanExiHS_DAOA.
GenevestigatoriP59103.

Organism-specific databases

HPAiHPA053114.

Interactioni

Subunit structurei

Associates with D-amino acid oxidase (DAAO).

Protein-protein interaction databases

IntActiP59103. 1 interaction.
MINTiMINT-8204618.
STRINGi9606.ENSP00000365103.

Family & Domainsi

Phylogenomic databases

eggNOGiNOG138778.
HOGENOMiHOG000112142.
InParanoidiP59103.
OMAiLENSCRE.
OrthoDBiEOG7ZSHVM.
PhylomeDBiP59103.
TreeFamiTF354179.

Family and domain databases

InterProiIPR027929. DAOA.
[Graphical view]
PfamiPF15199. DAOA. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P59103-1) [UniParc]FASTAAdd to Basket

Also known as: LG72

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MLEKLMGADS LQLFRSRYTL GKIYFIGFQR SILLSKSENS LNSIAKETEE    50
GRETVTRKEG WKRRHEDGYL EMAQRHLQRS LCPWVSYLPQ PYAELEEVSS 100
HVGKVFMARN YEFLAYEASK DRRQPLERMW TCNYNQQKDQ SCNHKEITST 150
KAE 153

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Length:153
Mass (Da):18,108
Last modified:December 20, 2005 - v2
Checksum:i597E2DE432A48EAE
GO
Isoform 2 (identifier: P59103-2) [UniParc]FASTAAdd to Basket

Also known as: SG72

The sequence of this isoform differs from the canonical sequence as follows:
     16-16: S → V
     17-153: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.

Show »
Length:16
Mass (Da):1,851
Checksum:iB7B6CDA012257A99
GO
Isoform 3 (identifier: P59103-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: Missing.

Show »
Length:82
Mass (Da):9,783
Checksum:iEB1DEE2851A277D7
GO
Isoform 4 (identifier: P59103-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     95-153: LEEVSSHVGK...HKEITSTKAE → HSKVILNGNLHCHFKRISQIFAGHFMEGDTEA

Show »
Length:126
Mass (Da):14,719
Checksum:i56FCB698164657FF
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti30 – 301R → K.1 Publication
Corresponds to variant rs2391191 [ dbSNP | Ensembl ].
VAR_014313
Natural varianti62 – 621K → E.
Corresponds to variant rs9558562 [ dbSNP | Ensembl ].
VAR_050943

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 7171Missing in isoform 3. VSP_044292Add
BLAST
Alternative sequencei16 – 161S → V in isoform 2. VSP_004053
Alternative sequencei17 – 153137Missing in isoform 2. VSP_004054Add
BLAST
Alternative sequencei95 – 15359LEEVS…STKAE → HSKVILNGNLHCHFKRISQI FAGHFMEGDTEA in isoform 4. VSP_044293Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AE014294 Genomic DNA. Translation: AAN16027.1.
AE014294 Genomic DNA. Translation: AAN16028.1.
AY138546 mRNA. Translation: AAN08432.1.
AY138547 mRNA. Translation: AAN08433.1.
AY170469 mRNA. Translation: AAO12727.1.
AY223901 mRNA. Translation: AAO73604.1.
DQ343761 mRNA. Translation: ABC59904.1.
DQ357223 mRNA. Translation: ABC86111.1.
AL359751 Genomic DNA. Translation: CAH70815.1.
CH471085 Genomic DNA. Translation: EAX09080.1.
BC121091 mRNA. Translation: AAI21092.1.
CCDSiCCDS41905.1. [P59103-1]
CCDS53880.1. [P59103-3]
RefSeqiNP_001155284.1. NM_001161812.1.
NP_001155286.1. NM_001161814.1. [P59103-3]
NP_758958.3. NM_172370.4. [P59103-1]
XP_005254099.1. XM_005254042.1. [P59103-4]
UniGeneiHs.381382.

Genome annotation databases

EnsembliENST00000329625; ENSP00000329951; ENSG00000182346. [P59103-3]
ENST00000375936; ENSP00000365103; ENSG00000182346. [P59103-1]
ENST00000473269; ENSP00000470244; ENSG00000182346. [P59103-4]
ENST00000559369; ENSP00000453831; ENSG00000182346. [P59103-3]
ENST00000600388; ENSP00000472260; ENSG00000182346. [P59103-3]
GeneIDi267012.
KEGGihsa:267012.
UCSCiuc001vqb.3. human. [P59103-1]

Polymorphism databases

DMDMi84028201.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AE014294 Genomic DNA. Translation: AAN16027.1 .
AE014294 Genomic DNA. Translation: AAN16028.1 .
AY138546 mRNA. Translation: AAN08432.1 .
AY138547 mRNA. Translation: AAN08433.1 .
AY170469 mRNA. Translation: AAO12727.1 .
AY223901 mRNA. Translation: AAO73604.1 .
DQ343761 mRNA. Translation: ABC59904.1 .
DQ357223 mRNA. Translation: ABC86111.1 .
AL359751 Genomic DNA. Translation: CAH70815.1 .
CH471085 Genomic DNA. Translation: EAX09080.1 .
BC121091 mRNA. Translation: AAI21092.1 .
CCDSi CCDS41905.1. [P59103-1 ]
CCDS53880.1. [P59103-3 ]
RefSeqi NP_001155284.1. NM_001161812.1.
NP_001155286.1. NM_001161814.1. [P59103-3 ]
NP_758958.3. NM_172370.4. [P59103-1 ]
XP_005254099.1. XM_005254042.1. [P59103-4 ]
UniGenei Hs.381382.

3D structure databases

ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

IntActi P59103. 1 interaction.
MINTi MINT-8204618.
STRINGi 9606.ENSP00000365103.

Polymorphism databases

DMDMi 84028201.

Proteomic databases

PaxDbi P59103.
PRIDEi P59103.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000329625 ; ENSP00000329951 ; ENSG00000182346 . [P59103-3 ]
ENST00000375936 ; ENSP00000365103 ; ENSG00000182346 . [P59103-1 ]
ENST00000473269 ; ENSP00000470244 ; ENSG00000182346 . [P59103-4 ]
ENST00000559369 ; ENSP00000453831 ; ENSG00000182346 . [P59103-3 ]
ENST00000600388 ; ENSP00000472260 ; ENSG00000182346 . [P59103-3 ]
GeneIDi 267012.
KEGGi hsa:267012.
UCSCi uc001vqb.3. human. [P59103-1 ]

Organism-specific databases

CTDi 267012.
GeneCardsi GC13P106118.
HGNCi HGNC:21191. DAOA.
HPAi HPA053114.
MIMi 607408. gene.
neXtProti NX_P59103.
PharmGKBi PA134924986.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG138778.
HOGENOMi HOG000112142.
InParanoidi P59103.
OMAi LENSCRE.
OrthoDBi EOG7ZSHVM.
PhylomeDBi P59103.
TreeFami TF354179.

Miscellaneous databases

GenomeRNAii 267012.
NextBioi 93398.
PROi P59103.
SOURCEi Search...

Gene expression databases

ArrayExpressi P59103.
CleanExi HS_DAOA.
Genevestigatori P59103.

Family and domain databases

InterProi IPR027929. DAOA.
[Graphical view ]
Pfami PF15199. DAOA. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Genetic and physiological data implicating the new human gene G72 and the gene for D-amino acid oxidase in schizophrenia."
    Chumakov I., Blumenfeld M., Guerassimenko O., Cavarec L., Palicio M., Abderrahim H., Bougueleret L., Barry C., Tanaka H., La Rosa P., Puech A., Tahri N., Cohen-Akenine A., Delabrosse S., Lissarrague S., Picard F.-P., Maurice K., Essioux L.
    , Millasseau P., Grel P., Debailleul V., Simon A.-M., Caterina D., Dufaure I., Malekzadeh K., Belova M., Luan J.-J., Bouillot M., Sambucy J.-L., Primas G., Saumier M., Boubkiri N., Martin-Saumier S., Nasroune M., Peixoto H., Delaye A., Pinchot V., Bastucci M., Guillou S., Chevillon M., Sainz-Fuertes R., Meguenni S., Aurich-Costa J., Cherif D., Gimalac A., Van Duijn C., Gauvreau D., Ouellette G., Fortier I., Raelson J., Sherbatich T., Riazanskay N., Rogaev E., Raeymaekers P., Aerssens J., Konings F., Luyten W., Macciardi F., Sham P.C., Straub R.E., Weinberger D.R., Cohen N., Cohen D.
    Proc. Natl. Acad. Sci. U.S.A. 99:13675-13680(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1), ALTERNATIVE SPLICING, VARIANT LYS-30, INTERACTION WITH DAAO.
  2. "Polymorphisms at the G72/G30 gene locus, on 13q33, are associated with bipolar disorder in two independent pedigree series."
    Hattori E., Liu C., Badner J.A., Bonner T.I., Christian S.L., Maheshwari M., Detera-Wadleigh S.D., Gibbs R.A., Gershon E.S.
    Am. J. Hum. Genet. 72:1131-1140(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3 AND 4).
    Tissue: Brain and Testis.
  3. "Expression profile of G72 gene in human brain and G72 transgenic mice brain."
    Cheng L., Gershon E.S., Liu C.
    Submitted (DEC-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
    Tissue: Amygdala.
  4. "The DNA sequence and analysis of human chromosome 13."
    Dunham A., Matthews L.H., Burton J., Ashurst J.L., Howe K.L., Ashcroft K.J., Beare D.M., Burford D.C., Hunt S.E., Griffiths-Jones S., Jones M.C., Keenan S.J., Oliver K., Scott C.E., Ainscough R., Almeida J.P., Ambrose K.D., Andrews D.T.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Bannerjee R., Barlow K.F., Bates K., Beasley H., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burrill W., Carder C., Carter N.P., Chapman J.C., Clamp M.E., Clark S.Y., Clarke G., Clee C.M., Clegg S.C., Cobley V., Collins J.E., Corby N., Coville G.J., Deloukas P., Dhami P., Dunham I., Dunn M., Earthrowl M.E., Ellington A.G., Faulkner L., Frankish A.G., Frankland J., French L., Garner P., Garnett J., Gilbert J.G.R., Gilson C.J., Ghori J., Grafham D.V., Gribble S.M., Griffiths C., Hall R.E., Hammond S., Harley J.L., Hart E.A., Heath P.D., Howden P.J., Huckle E.J., Hunt P.J., Hunt A.R., Johnson C., Johnson D., Kay M., Kimberley A.M., King A., Laird G.K., Langford C.J., Lawlor S., Leongamornlert D.A., Lloyd D.M., Lloyd C., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., McLaren S.J., McMurray A., Milne S., Moore M.J.F., Nickerson T., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K.M., Rice C.M., Searle S., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Steward C.A., Sycamore N., Tester J., Thomas D.W., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Wilming L., Wray P.W., Wright M.W., Young L., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Beck S., Bentley D.R., Rogers J., Ross M.T.
    Nature 428:522-528(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  7. Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S).

Entry informationi

Entry nameiDAOA_HUMAN
AccessioniPrimary (citable) accession number: P59103
Secondary accession number(s): A6NKG7
, Q0VAE6, Q5VX59, Q86Y17, Q8IWM4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 25, 2002
Last sequence update: December 20, 2005
Last modified: July 9, 2014
This is version 90 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 13
    Human chromosome 13: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

External Data

Dasty 3

Similar proteinsi