Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

D-amino acid oxidase activator

Gene

DAOA

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Seems to activate D-amino acid oxidase.

GO - Molecular functioni

  • enzyme activator activity Source: UniProtKB
  • enzyme binding Source: UniProtKB

GO - Biological processi

  • negative regulation of D-amino-acid oxidase activity Source: UniProtKB
  • positive regulation of catalytic activity Source: UniProtKB

Names & Taxonomyi

Protein namesi
Recommended name:
D-amino acid oxidase activator
Alternative name(s):
Protein G72
Gene namesi
Name:DAOA
Synonyms:G72
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 13

Organism-specific databases

EuPathDBiHostDB:ENSG00000182346.17
HGNCiHGNC:21191 DAOA
MIMi607408 gene
neXtProtiNX_P59103

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Golgi apparatus

Pathology & Biotechi

Involvement in diseasei

Schizophrenia (SCZD)1 Publication
Disease susceptibility may be associated with variations affecting the gene represented in this entry.
Disease descriptionA complex, multifactorial psychotic disorder or group of disorders characterized by disturbances in the form and content of thought (e.g. delusions, hallucinations), in mood (e.g. inappropriate affect), in sense of self and relationship to the external world (e.g. loss of ego boundaries, withdrawal), and in behavior (e.g bizarre or apparently purposeless behavior). Although it affects emotions, it is distinguished from mood disorders in which such disturbances are primary. Similarly, there may be mild impairment of cognitive function, and it is distinguished from the dementias in which disturbed cognitive function is considered primary. Some patients manifest schizophrenic as well as bipolar disorder symptoms and are often given the diagnosis of schizoaffective disorder.
See also OMIM:181500

Keywords - Diseasei

Schizophrenia

Organism-specific databases

DisGeNETi267012
MalaCardsiDAOA
MIMi181500 phenotype
OpenTargetsiENSG00000182346
PharmGKBiPA134924986

Polymorphism and mutation databases

BioMutaiDAOA
DMDMi84028201

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000797811 – 153D-amino acid oxidase activatorAdd BLAST153

Proteomic databases

PaxDbiP59103
PRIDEiP59103

Expressioni

Tissue specificityi

Expressed in amygdala, caudate nucleus, spinal cord and testis.

Gene expression databases

BgeeiENSG00000182346
CleanExiHS_DAOA
ExpressionAtlasiP59103 baseline and differential
GenevisibleiP59103 HS

Organism-specific databases

HPAiHPA053114

Interactioni

Subunit structurei

Associates with D-amino acid oxidase (DAAO).1 Publication

GO - Molecular functioni

  • enzyme binding Source: UniProtKB

Protein-protein interaction databases

IntActiP59103, 1 interactor
MINTiP59103
STRINGi9606.ENSP00000365103

Structurei

3D structure databases

ProteinModelPortaliP59103
SMRiP59103
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Phylogenomic databases

eggNOGiENOG410KIB9 Eukaryota
ENOG4110QEM LUCA
GeneTreeiENSGT00410000028557
HOGENOMiHOG000112142
InParanoidiP59103
OMAiCPRVSYL
OrthoDBiEOG091G0PUQ
PhylomeDBiP59103
TreeFamiTF354179

Family and domain databases

InterProiView protein in InterPro
IPR027929 DAOA
PfamiView protein in Pfam
PF15199 DAOA, 1 hit

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P59103-1) [UniParc]FASTAAdd to basket
Also known as: LG72

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLEKLMGADS LQLFRSRYTL GKIYFIGFQR SILLSKSENS LNSIAKETEE
60 70 80 90 100
GRETVTRKEG WKRRHEDGYL EMAQRHLQRS LCPWVSYLPQ PYAELEEVSS
110 120 130 140 150
HVGKVFMARN YEFLAYEASK DRRQPLERMW TCNYNQQKDQ SCNHKEITST

KAE
Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Length:153
Mass (Da):18,108
Last modified:December 20, 2005 - v2
Checksum:i597E2DE432A48EAE
GO
Isoform 2 (identifier: P59103-2) [UniParc]FASTAAdd to basket
Also known as: SG72

The sequence of this isoform differs from the canonical sequence as follows:
     16-16: S → V
     17-153: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.
Show »
Length:16
Mass (Da):1,851
Checksum:iB7B6CDA012257A99
GO
Isoform 3 (identifier: P59103-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: Missing.

Show »
Length:82
Mass (Da):9,783
Checksum:iEB1DEE2851A277D7
GO
Isoform 4 (identifier: P59103-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     95-153: LEEVSSHVGK...HKEITSTKAE → HSKVILNGNLHCHFKRISQIFAGHFMEGDTEA

Show »
Length:126
Mass (Da):14,719
Checksum:i56FCB698164657FF
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_01431330R → K1 PublicationCorresponds to variant dbSNP:rs2391191Ensembl.1
Natural variantiVAR_05094362K → E. Corresponds to variant dbSNP:rs9558562Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0442921 – 71Missing in isoform 3. 2 PublicationsAdd BLAST71
Alternative sequenceiVSP_00405316S → V in isoform 2. Curated1
Alternative sequenceiVSP_00405417 – 153Missing in isoform 2. CuratedAdd BLAST137
Alternative sequenceiVSP_04429395 – 153LEEVS…STKAE → HSKVILNGNLHCHFKRISQI FAGHFMEGDTEA in isoform 4. 1 PublicationAdd BLAST59

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AE014294 Genomic DNA Translation: AAN16027.1
AE014294 Genomic DNA Translation: AAN16028.1
AY138546 mRNA Translation: AAN08432.1
AY138547 mRNA Translation: AAN08433.1
AY170469 mRNA Translation: AAO12727.1
AY223901 mRNA Translation: AAO73604.1
DQ343761 mRNA Translation: ABC59904.1
DQ357223 mRNA Translation: ABC86111.1
AL359751 Genomic DNA No translation available.
CH471085 Genomic DNA Translation: EAX09080.1
BC121091 mRNA Translation: AAI21092.1
CCDSiCCDS41905.1 [P59103-1]
CCDS53880.1 [P59103-3]
RefSeqiNP_001155284.1, NM_001161812.1
NP_001155286.1, NM_001161814.1 [P59103-3]
NP_758958.3, NM_172370.4 [P59103-1]
XP_005254099.1, XM_005254042.1 [P59103-4]
UniGeneiHs.381382

Genome annotation databases

EnsembliENST00000329625; ENSP00000329951; ENSG00000182346 [P59103-3]
ENST00000375936; ENSP00000365103; ENSG00000182346 [P59103-1]
ENST00000473269; ENSP00000470244; ENSG00000182346 [P59103-4]
ENST00000559369; ENSP00000453831; ENSG00000182346 [P59103-3]
ENST00000600388; ENSP00000472260; ENSG00000182346 [P59103-3]
ENST00000618629; ENSP00000483757; ENSG00000182346 [P59103-1]
GeneIDi267012
KEGGihsa:267012
UCSCiuc001vqb.5 human [P59103-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiDAOA_HUMAN
AccessioniPrimary (citable) accession number: P59103
Secondary accession number(s): A6NKG7
, Q0VAE6, Q5VX59, Q86Y17, Q8IWM4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 25, 2002
Last sequence update: December 20, 2005
Last modified: February 28, 2018
This is version 114 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health