Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P59103 (DAOA_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 90. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
D-amino acid oxidase activator
Alternative name(s):
Protein G72
Gene names
Name:DAOA
Synonyms:G72
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length153 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Seems to activate D-amino acid oxidase.

Subunit structure

Associates with D-amino acid oxidase (DAAO).

Subcellular location

Golgi apparatus.

Tissue specificity

Expressed in amygdala, caudate nucleus, spinal cord and testis.

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: P59103-1)

Also known as: LG72;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Isoform 2 (identifier: P59103-2)

Also known as: SG72;

The sequence of this isoform differs from the canonical sequence as follows:
     16-16: S → V
     17-153: Missing.
Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.
Isoform 3 (identifier: P59103-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: Missing.
Isoform 4 (identifier: P59103-4)

The sequence of this isoform differs from the canonical sequence as follows:
     95-153: LEEVSSHVGK...HKEITSTKAE → HSKVILNGNLHCHFKRISQIFAGHFMEGDTEA

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 153153D-amino acid oxidase activator
PRO_0000079781

Natural variations

Alternative sequence1 – 7171Missing in isoform 3.
VSP_044292
Alternative sequence161S → V in isoform 2.
VSP_004053
Alternative sequence17 – 153137Missing in isoform 2.
VSP_004054
Alternative sequence95 – 15359LEEVS…STKAE → HSKVILNGNLHCHFKRISQI FAGHFMEGDTEA in isoform 4.
VSP_044293
Natural variant301R → K. Ref.1
Corresponds to variant rs2391191 [ dbSNP | Ensembl ].
VAR_014313
Natural variant621K → E.
Corresponds to variant rs9558562 [ dbSNP | Ensembl ].
VAR_050943

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (LG72) [UniParc].

Last modified December 20, 2005. Version 2.
Checksum: 597E2DE432A48EAE

FASTA15318,108
        10         20         30         40         50         60 
MLEKLMGADS LQLFRSRYTL GKIYFIGFQR SILLSKSENS LNSIAKETEE GRETVTRKEG 

        70         80         90        100        110        120 
WKRRHEDGYL EMAQRHLQRS LCPWVSYLPQ PYAELEEVSS HVGKVFMARN YEFLAYEASK 

       130        140        150 
DRRQPLERMW TCNYNQQKDQ SCNHKEITST KAE 

« Hide

Isoform 2 (SG72) [UniParc].

Checksum: B7B6CDA012257A99
Show »

FASTA161,851
Isoform 3 [UniParc].

Checksum: EB1DEE2851A277D7
Show »

FASTA829,783
Isoform 4 [UniParc].

Checksum: 56FCB698164657FF
Show »

FASTA12614,719

References

« Hide 'large scale' references
[1]"Genetic and physiological data implicating the new human gene G72 and the gene for D-amino acid oxidase in schizophrenia."
Chumakov I., Blumenfeld M., Guerassimenko O., Cavarec L., Palicio M., Abderrahim H., Bougueleret L., Barry C., Tanaka H., La Rosa P., Puech A., Tahri N., Cohen-Akenine A., Delabrosse S., Lissarrague S., Picard F.-P., Maurice K., Essioux L. expand/collapse author list , Millasseau P., Grel P., Debailleul V., Simon A.-M., Caterina D., Dufaure I., Malekzadeh K., Belova M., Luan J.-J., Bouillot M., Sambucy J.-L., Primas G., Saumier M., Boubkiri N., Martin-Saumier S., Nasroune M., Peixoto H., Delaye A., Pinchot V., Bastucci M., Guillou S., Chevillon M., Sainz-Fuertes R., Meguenni S., Aurich-Costa J., Cherif D., Gimalac A., Van Duijn C., Gauvreau D., Ouellette G., Fortier I., Raelson J., Sherbatich T., Riazanskay N., Rogaev E., Raeymaekers P., Aerssens J., Konings F., Luyten W., Macciardi F., Sham P.C., Straub R.E., Weinberger D.R., Cohen N., Cohen D.
Proc. Natl. Acad. Sci. U.S.A. 99:13675-13680(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1), ALTERNATIVE SPLICING, VARIANT LYS-30, INTERACTION WITH DAAO.
[2]"Polymorphisms at the G72/G30 gene locus, on 13q33, are associated with bipolar disorder in two independent pedigree series."
Hattori E., Liu C., Badner J.A., Bonner T.I., Christian S.L., Maheshwari M., Detera-Wadleigh S.D., Gibbs R.A., Gershon E.S.
Am. J. Hum. Genet. 72:1131-1140(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3 AND 4).
Tissue: Brain and Testis.
[3]"Expression profile of G72 gene in human brain and G72 transgenic mice brain."
Cheng L., Gershon E.S., Liu C.
Submitted (DEC-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
Tissue: Amygdala.
[4]"The DNA sequence and analysis of human chromosome 13."
Dunham A., Matthews L.H., Burton J., Ashurst J.L., Howe K.L., Ashcroft K.J., Beare D.M., Burford D.C., Hunt S.E., Griffiths-Jones S., Jones M.C., Keenan S.J., Oliver K., Scott C.E., Ainscough R., Almeida J.P., Ambrose K.D., Andrews D.T. expand/collapse author list , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Bannerjee R., Barlow K.F., Bates K., Beasley H., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burrill W., Carder C., Carter N.P., Chapman J.C., Clamp M.E., Clark S.Y., Clarke G., Clee C.M., Clegg S.C., Cobley V., Collins J.E., Corby N., Coville G.J., Deloukas P., Dhami P., Dunham I., Dunn M., Earthrowl M.E., Ellington A.G., Faulkner L., Frankish A.G., Frankland J., French L., Garner P., Garnett J., Gilbert J.G.R., Gilson C.J., Ghori J., Grafham D.V., Gribble S.M., Griffiths C., Hall R.E., Hammond S., Harley J.L., Hart E.A., Heath P.D., Howden P.J., Huckle E.J., Hunt P.J., Hunt A.R., Johnson C., Johnson D., Kay M., Kimberley A.M., King A., Laird G.K., Langford C.J., Lawlor S., Leongamornlert D.A., Lloyd D.M., Lloyd C., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., McLaren S.J., McMurray A., Milne S., Moore M.J.F., Nickerson T., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K.M., Rice C.M., Searle S., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Steward C.A., Sycamore N., Tester J., Thomas D.W., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Wilming L., Wray P.W., Wright M.W., Young L., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Beck S., Bentley D.R., Rogers J., Ross M.T.
Nature 428:522-528(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[7]"An unappreciated role for RNA surveillance."
Hillman R.T., Green R.E., Brenner S.E.
Genome Biol. 5:R8.1-R8.16(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S).
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AE014294 Genomic DNA. Translation: AAN16027.1.
AE014294 Genomic DNA. Translation: AAN16028.1.
AY138546 mRNA. Translation: AAN08432.1.
AY138547 mRNA. Translation: AAN08433.1.
AY170469 mRNA. Translation: AAO12727.1.
AY223901 mRNA. Translation: AAO73604.1.
DQ343761 mRNA. Translation: ABC59904.1.
DQ357223 mRNA. Translation: ABC86111.1.
AL359751 Genomic DNA. Translation: CAH70815.1.
CH471085 Genomic DNA. Translation: EAX09080.1.
BC121091 mRNA. Translation: AAI21092.1.
CCDSCCDS41905.1. [P59103-1]
CCDS53880.1. [P59103-3]
RefSeqNP_001155284.1. NM_001161812.1.
NP_001155286.1. NM_001161814.1. [P59103-3]
NP_758958.3. NM_172370.4. [P59103-1]
XP_005254099.1. XM_005254042.1. [P59103-4]
UniGeneHs.381382.

3D structure databases

ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

IntActP59103. 1 interaction.
MINTMINT-8204618.
STRING9606.ENSP00000365103.

Polymorphism databases

DMDM84028201.

Proteomic databases

PaxDbP59103.
PRIDEP59103.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000329625; ENSP00000329951; ENSG00000182346. [P59103-3]
ENST00000375936; ENSP00000365103; ENSG00000182346. [P59103-1]
ENST00000473269; ENSP00000470244; ENSG00000182346. [P59103-4]
ENST00000559369; ENSP00000453831; ENSG00000182346. [P59103-3]
ENST00000600388; ENSP00000472260; ENSG00000182346. [P59103-3]
GeneID267012.
KEGGhsa:267012.
UCSCuc001vqb.3. human. [P59103-1]

Organism-specific databases

CTD267012.
GeneCardsGC13P106118.
HGNCHGNC:21191. DAOA.
HPAHPA053114.
MIM607408. gene.
neXtProtNX_P59103.
PharmGKBPA134924986.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG138778.
HOGENOMHOG000112142.
InParanoidP59103.
OMALENSCRE.
OrthoDBEOG7ZSHVM.
PhylomeDBP59103.
TreeFamTF354179.

Gene expression databases

ArrayExpressP59103.
CleanExHS_DAOA.
GenevestigatorP59103.

Family and domain databases

InterProIPR027929. DAOA.
[Graphical view]
PfamPF15199. DAOA. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi267012.
NextBio93398.
PROP59103.
SOURCESearch...

Entry information

Entry nameDAOA_HUMAN
AccessionPrimary (citable) accession number: P59103
Secondary accession number(s): A6NKG7 expand/collapse secondary AC list , Q0VAE6, Q5VX59, Q86Y17, Q8IWM4
Entry history
Integrated into UniProtKB/Swiss-Prot: November 25, 2002
Last sequence update: December 20, 2005
Last modified: July 9, 2014
This is version 90 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 13

Human chromosome 13: entries, gene names and cross-references to MIM