Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

D-amino acid oxidase activator

Gene

DAOA

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Seems to activate D-amino acid oxidase.

GO - Molecular functioni

  • enzyme activator activity Source: UniProtKB
  • enzyme binding Source: UniProtKB

GO - Biological processi

  • negative regulation of D-amino-acid oxidase activity Source: UniProtKB
  • positive regulation of catalytic activity Source: UniProtKB
Complete GO annotation...

Enzyme and pathway databases

BioCyciZFISH:G66-30786-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
D-amino acid oxidase activator
Alternative name(s):
Protein G72
Gene namesi
Name:DAOA
Synonyms:G72
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 13

Organism-specific databases

HGNCiHGNC:21191. DAOA.

Subcellular locationi

GO - Cellular componenti

  • Golgi apparatus Source: UniProtKB
  • mitochondrion Source: UniProtKB
  • perinuclear region of cytoplasm Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Golgi apparatus

Pathology & Biotechi

Organism-specific databases

DisGeNETi267012.
MalaCardsiDAOA.
OpenTargetsiENSG00000182346.
PharmGKBiPA134924986.

Polymorphism and mutation databases

BioMutaiDAOA.
DMDMi84028201.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000797811 – 153D-amino acid oxidase activatorAdd BLAST153

Proteomic databases

PaxDbiP59103.
PRIDEiP59103.

Expressioni

Tissue specificityi

Expressed in amygdala, caudate nucleus, spinal cord and testis.

Gene expression databases

CleanExiHS_DAOA.
ExpressionAtlasiP59103. baseline and differential.
GenevisibleiP59103. HS.

Organism-specific databases

HPAiHPA053114.

Interactioni

Subunit structurei

Associates with D-amino acid oxidase (DAAO).

GO - Molecular functioni

  • enzyme binding Source: UniProtKB

Protein-protein interaction databases

IntActiP59103. 1 interactor.
MINTiMINT-8204618.
STRINGi9606.ENSP00000365103.

Structurei

3D structure databases

ProteinModelPortaliP59103.
SMRiP59103.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Phylogenomic databases

eggNOGiENOG410KIB9. Eukaryota.
ENOG4110QEM. LUCA.
GeneTreeiENSGT00410000028557.
HOGENOMiHOG000112142.
InParanoidiP59103.
OMAiARNYEAS.
OrthoDBiEOG091G0PUQ.
PhylomeDBiP59103.
TreeFamiTF354179.

Family and domain databases

InterProiIPR027929. DAOA.
[Graphical view]
PfamiPF15199. DAOA. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P59103-1) [UniParc]FASTAAdd to basket
Also known as: LG72

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLEKLMGADS LQLFRSRYTL GKIYFIGFQR SILLSKSENS LNSIAKETEE
60 70 80 90 100
GRETVTRKEG WKRRHEDGYL EMAQRHLQRS LCPWVSYLPQ PYAELEEVSS
110 120 130 140 150
HVGKVFMARN YEFLAYEASK DRRQPLERMW TCNYNQQKDQ SCNHKEITST

KAE
Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Length:153
Mass (Da):18,108
Last modified:December 20, 2005 - v2
Checksum:i597E2DE432A48EAE
GO
Isoform 2 (identifier: P59103-2) [UniParc]FASTAAdd to basket
Also known as: SG72

The sequence of this isoform differs from the canonical sequence as follows:
     16-16: S → V
     17-153: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.
Show »
Length:16
Mass (Da):1,851
Checksum:iB7B6CDA012257A99
GO
Isoform 3 (identifier: P59103-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: Missing.

Show »
Length:82
Mass (Da):9,783
Checksum:iEB1DEE2851A277D7
GO
Isoform 4 (identifier: P59103-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     95-153: LEEVSSHVGK...HKEITSTKAE → HSKVILNGNLHCHFKRISQIFAGHFMEGDTEA

Show »
Length:126
Mass (Da):14,719
Checksum:i56FCB698164657FF
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_01431330R → K.1 PublicationCorresponds to variant rs2391191dbSNPEnsembl.1
Natural variantiVAR_05094362K → E.Corresponds to variant rs9558562dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0442921 – 71Missing in isoform 3. 2 PublicationsAdd BLAST71
Alternative sequenceiVSP_00405316S → V in isoform 2. Curated1
Alternative sequenceiVSP_00405417 – 153Missing in isoform 2. CuratedAdd BLAST137
Alternative sequenceiVSP_04429395 – 153LEEVS…STKAE → HSKVILNGNLHCHFKRISQI FAGHFMEGDTEA in isoform 4. 1 PublicationAdd BLAST59

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AE014294 Genomic DNA. Translation: AAN16027.1.
AE014294 Genomic DNA. Translation: AAN16028.1.
AY138546 mRNA. Translation: AAN08432.1.
AY138547 mRNA. Translation: AAN08433.1.
AY170469 mRNA. Translation: AAO12727.1.
AY223901 mRNA. Translation: AAO73604.1.
DQ343761 mRNA. Translation: ABC59904.1.
DQ357223 mRNA. Translation: ABC86111.1.
AL359751 Genomic DNA. Translation: CAH70815.1.
CH471085 Genomic DNA. Translation: EAX09080.1.
BC121091 mRNA. Translation: AAI21092.1.
CCDSiCCDS41905.1. [P59103-1]
CCDS53880.1. [P59103-3]
RefSeqiNP_001155284.1. NM_001161812.1.
NP_001155286.1. NM_001161814.1. [P59103-3]
NP_758958.3. NM_172370.4. [P59103-1]
XP_005254099.1. XM_005254042.1. [P59103-4]
UniGeneiHs.381382.

Genome annotation databases

EnsembliENST00000329625; ENSP00000329951; ENSG00000182346. [P59103-3]
ENST00000375936; ENSP00000365103; ENSG00000182346. [P59103-1]
ENST00000473269; ENSP00000470244; ENSG00000182346. [P59103-4]
ENST00000559369; ENSP00000453831; ENSG00000182346. [P59103-3]
ENST00000600388; ENSP00000472260; ENSG00000182346. [P59103-3]
ENST00000618629; ENSP00000483757; ENSG00000182346. [P59103-1]
GeneIDi267012.
KEGGihsa:267012.
UCSCiuc001vqb.5. human. [P59103-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AE014294 Genomic DNA. Translation: AAN16027.1.
AE014294 Genomic DNA. Translation: AAN16028.1.
AY138546 mRNA. Translation: AAN08432.1.
AY138547 mRNA. Translation: AAN08433.1.
AY170469 mRNA. Translation: AAO12727.1.
AY223901 mRNA. Translation: AAO73604.1.
DQ343761 mRNA. Translation: ABC59904.1.
DQ357223 mRNA. Translation: ABC86111.1.
AL359751 Genomic DNA. Translation: CAH70815.1.
CH471085 Genomic DNA. Translation: EAX09080.1.
BC121091 mRNA. Translation: AAI21092.1.
CCDSiCCDS41905.1. [P59103-1]
CCDS53880.1. [P59103-3]
RefSeqiNP_001155284.1. NM_001161812.1.
NP_001155286.1. NM_001161814.1. [P59103-3]
NP_758958.3. NM_172370.4. [P59103-1]
XP_005254099.1. XM_005254042.1. [P59103-4]
UniGeneiHs.381382.

3D structure databases

ProteinModelPortaliP59103.
SMRiP59103.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiP59103. 1 interactor.
MINTiMINT-8204618.
STRINGi9606.ENSP00000365103.

Polymorphism and mutation databases

BioMutaiDAOA.
DMDMi84028201.

Proteomic databases

PaxDbiP59103.
PRIDEiP59103.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000329625; ENSP00000329951; ENSG00000182346. [P59103-3]
ENST00000375936; ENSP00000365103; ENSG00000182346. [P59103-1]
ENST00000473269; ENSP00000470244; ENSG00000182346. [P59103-4]
ENST00000559369; ENSP00000453831; ENSG00000182346. [P59103-3]
ENST00000600388; ENSP00000472260; ENSG00000182346. [P59103-3]
ENST00000618629; ENSP00000483757; ENSG00000182346. [P59103-1]
GeneIDi267012.
KEGGihsa:267012.
UCSCiuc001vqb.5. human. [P59103-1]

Organism-specific databases

CTDi267012.
DisGeNETi267012.
GeneCardsiDAOA.
HGNCiHGNC:21191. DAOA.
HPAiHPA053114.
MalaCardsiDAOA.
MIMi607408. gene.
neXtProtiNX_P59103.
OpenTargetsiENSG00000182346.
PharmGKBiPA134924986.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410KIB9. Eukaryota.
ENOG4110QEM. LUCA.
GeneTreeiENSGT00410000028557.
HOGENOMiHOG000112142.
InParanoidiP59103.
OMAiARNYEAS.
OrthoDBiEOG091G0PUQ.
PhylomeDBiP59103.
TreeFamiTF354179.

Enzyme and pathway databases

BioCyciZFISH:G66-30786-MONOMER.

Miscellaneous databases

GenomeRNAii267012.
PROiP59103.
SOURCEiSearch...

Gene expression databases

CleanExiHS_DAOA.
ExpressionAtlasiP59103. baseline and differential.
GenevisibleiP59103. HS.

Family and domain databases

InterProiIPR027929. DAOA.
[Graphical view]
PfamiPF15199. DAOA. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiDAOA_HUMAN
AccessioniPrimary (citable) accession number: P59103
Secondary accession number(s): A6NKG7
, Q0VAE6, Q5VX59, Q86Y17, Q8IWM4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 25, 2002
Last sequence update: December 20, 2005
Last modified: November 2, 2016
This is version 106 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 13
    Human chromosome 13: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.