Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P59046

- NAL12_HUMAN

UniProt

P59046 - NAL12_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

NACHT, LRR and PYD domains-containing protein 12

Gene

NLRP12

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

May mediate activation of CASP1 via ASC and promote activation of NF-kappa-B via IKK.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi217 – 2248ATP

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. cysteine-type endopeptidase activator activity involved in apoptotic process Source: UniProtKB

GO - Biological processi

  1. activation of cysteine-type endopeptidase activity involved in apoptotic process Source: UniProtKB
  2. cellular response to cytokine stimulus Source: Ensembl
  3. dendritic cell migration Source: Ensembl
  4. negative regulation of cytokine secretion Source: HGNC
  5. negative regulation of ERK1 and ERK2 cascade Source: Ensembl
  6. negative regulation of I-kappaB kinase/NF-kappaB signaling Source: HGNC
  7. negative regulation of inflammatory response Source: BHF-UCL
  8. negative regulation of interleukin-1 secretion Source: HGNC
  9. negative regulation of interleukin-6 biosynthetic process Source: HGNC
  10. negative regulation of NF-kappaB transcription factor activity Source: BHF-UCL
  11. negative regulation of NIK/NF-kappaB signaling Source: Ensembl
  12. negative regulation of protein autophosphorylation Source: HGNC
  13. negative regulation of signal transduction Source: HGNC
  14. negative regulation of Toll signaling pathway Source: HGNC
  15. positive regulation of inflammatory response Source: UniProtKB
  16. positive regulation of interleukin-1 beta secretion Source: UniProtKB
  17. positive regulation of MHC class I biosynthetic process Source: MGI
  18. regulation of cysteine-type endopeptidase activity involved in apoptotic process Source: MGI
  19. regulation of I-kappaB kinase/NF-kappaB signaling Source: MGI
  20. regulation of interleukin-18 biosynthetic process Source: UniProtKB
  21. release of cytoplasmic sequestered NF-kappaB Source: UniProtKB
  22. signal transduction Source: UniProtKB
Complete GO annotation...

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
NACHT, LRR and PYD domains-containing protein 12
Alternative name(s):
Monarch-1
PYRIN-containing APAF1-like protein 7
Regulated by nitric oxide
Gene namesi
Name:NLRP12
Synonyms:NALP12, PYPAF7, RNO
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 19

Organism-specific databases

HGNCiHGNC:22938. NLRP12.

Subcellular locationi

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Involvement in diseasei

Familial cold autoinflammatory syndrome 2 (FCAS2) [MIM:611762]: A rare autosomal dominant systemic inflammatory disease characterized by recurrent episodes of maculopapular rash associated with arthralgias, myalgias, fever and chills, swelling of the extremities, and conjunctivitis after generalized exposure to cold.1 Publication
Note: The disease is caused by mutations affecting the gene represented in this entry.

Organism-specific databases

MIMi611762. phenotype.
Orphaneti247868. NLRP12-associated hereditary periodic fever syndrome.
PharmGKBiPA162397866.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10611061NACHT, LRR and PYD domains-containing protein 12PRO_0000080899Add
BLAST

Proteomic databases

PaxDbiP59046.
PRIDEiP59046.

PTM databases

PhosphoSiteiP59046.

Expressioni

Tissue specificityi

Detected only in peripheral blood leukocytes, predominantly in eosinophils and granulocytes, and at lower levels in monocytes.1 Publication

Inductioni

By nitric oxide and DMSO in HL-60 cells, an acute myeloid leukemia cell line.1 Publication

Gene expression databases

BgeeiP59046.
CleanExiHS_NLRP12.
ExpressionAtlasiP59046. baseline and differential.
GenevestigatoriP59046.

Organism-specific databases

HPAiHPA042981.

Interactioni

Subunit structurei

Binds to ASC with its DAPIN domain. Interacts with FAF1 UBA domain via its DAPIN domain.1 Publication

Protein-protein interaction databases

BioGridi124861. 6 interactions.
IntActiP59046. 23 interactions.
MINTiMINT-237788.
STRINGi9606.ENSP00000319377.

Structurei

Secondary structure

1
1061
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi10 – 178Combined sources
Helixi22 – 3312Combined sources
Turni37 – 404Combined sources
Turni47 – 504Combined sources
Helixi53 – 6311Combined sources
Helixi66 – 7712Combined sources
Helixi78 – 803Combined sources
Helixi83 – 875Combined sources
Beta strandi95 – 984Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2L6ANMR-A1-98[»]
ProteinModelPortaliP59046.
SMRiP59046. Positions 1-98, 209-234, 632-1059.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP59046.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini1 – 9595DAPINPROSITE-ProRule annotationAdd
BLAST
Domaini211 – 528318NACHTPROSITE-ProRule annotationAdd
BLAST
Repeati828 – 84821LRR 1Add
BLAST
Repeati857 – 87822LRR 2Add
BLAST
Repeati885 – 90622LRR 3Add
BLAST
Repeati914 – 93522LRR 4Add
BLAST
Repeati942 – 96221LRR 5Add
BLAST
Repeati971 – 99222LRR 6Add
BLAST
Repeati999 – 102022LRR 7Add
BLAST
Repeati1028 – 104922LRR 8Add
BLAST

Sequence similaritiesi

Belongs to the NLRP family.Curated
Contains 1 DAPIN domain.PROSITE-ProRule annotation
Contains 8 LRR (leucine-rich) repeats.Curated
Contains 1 NACHT domain.PROSITE-ProRule annotation

Keywords - Domaini

Leucine-rich repeat, Repeat

Phylogenomic databases

eggNOGiNOG82860.
GeneTreeiENSGT00770000120466.
HOGENOMiHOG000294064.
HOVERGENiHBG063656.
InParanoidiP59046.
OrthoDBiEOG7P5T07.
PhylomeDBiP59046.
TreeFamiTF340267.

Family and domain databases

Gene3Di1.10.533.10. 1 hit.
InterProiIPR004020. DAPIN.
IPR011029. DEATH-like_dom.
IPR001611. Leu-rich_rpt.
IPR007111. NACHT_NTPase.
IPR029495. NATCH-assoc.
IPR027417. P-loop_NTPase.
[Graphical view]
PfamiPF14484. FISNA. 1 hit.
PF02758. PYRIN. 1 hit.
[Graphical view]
SUPFAMiSSF47986. SSF47986. 1 hit.
SSF52540. SSF52540. 1 hit.
PROSITEiPS50824. DAPIN. 1 hit.
PS51450. LRR. 5 hits.
PS50837. NACHT. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P59046-1) [UniParc]FASTAAdd to Basket

Also known as: I

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLRTAGRDGL CRLSTYLEEL EAVELKKFKL YLGTATELGE GKIPWGSMEK
60 70 80 90 100
AGPLEMAQLL ITHFGPEEAW RLALSTFERI NRKDLWERGQ REDLVRDTPP
110 120 130 140 150
GGPSSLGNQS TCLLEVSLVT PRKDPQETYR DYVRRKFRLM EDRNARLGEC
160 170 180 190 200
VNLSHRYTRL LLVKEHSNPM QVQQQLLDTG RGHARTVGHQ ASPIKIETLF
210 220 230 240 250
EPDEERPEPP RTVVMQGAAG IGKSMLAHKV MLDWADGKLF QGRFDYLFYI
260 270 280 290 300
NCREMNQSAT ECSMQDLIFS CWPEPSAPLQ ELIRVPERLL FIIDGFDELK
310 320 330 340 350
PSFHDPQGPW CLCWEEKRPT ELLLNSLIRK KLLPELSLLI TTRPTALEKL
360 370 380 390 400
HRLLEHPRHV EILGFSEAER KEYFYKYFHN AEQAGQVFNY VRDNEPLFTM
410 420 430 440 450
CFVPLVCWVV CTCLQQQLEG GGLLRQTSRT TTAVYMLYLL SLMQPKPGAP
460 470 480 490 500
RLQPPPNQRG LCSLAADGLW NQKILFEEQD LRKHGLDGED VSAFLNMNIF
510 520 530 540 550
QKDINCERYY SFIHLSFQEF FAAMYYILDE GEGGAGPDQD VTRLLTEYAF
560 570 580 590 600
SERSFLALTS RFLFGLLNEE TRSHLEKSLC WKVSPHIKMD LLQWIQSKAQ
610 620 630 640 650
SDGSTLQQGS LEFFSCLYEI QEEEFIQQAL SHFQVIVVSN IASKMEHMVS
660 670 680 690 700
SFCLKRCRSA QVLHLYGATY SADGEDRARC SAGAHTLLVQ LPERTVLLDA
710 720 730 740 750
YSEHLAAALC TNPNLIELSL YRNALGSRGV KLLCQGLRHP NCKLQNLRLK
760 770 780 790 800
RCRISSSACE DLSAALIANK NLTRMDLSGN GVGFPGMMLL CEGLRHPQCR
810 820 830 840 850
LQMIQLRKCQ LESGACQEMA SVLGTNPHLV ELDLTGNALE DLGLRLLCQG
860 870 880 890 900
LRHPVCRLRT LWLKICRLTA AACDELASTL SVNQSLRELD LSLNELGDLG
910 920 930 940 950
VLLLCEGLRH PTCKLQTLRL GICRLGSAAC EGLSVVLQAN HNLRELDLSF
960 970 980 990 1000
NDLGDWGLWL LAEGLQHPAC RLQKLWLDSC GLTAKACENL YFTLGINQTL
1010 1020 1030 1040 1050
TDLYLTNNAL GDTGVRLLCK RLSHPGCKLR VLWLFGMDLN KMTHSRLAAL
1060
RVTKPYLDIG C
Length:1,061
Mass (Da):120,173
Last modified:August 22, 2003 - v2
Checksum:i8C10AFE4907C131B
GO
Isoform 2 (identifier: P59046-2) [UniParc]FASTAAdd to Basket

Also known as: II

The sequence of this isoform differs from the canonical sequence as follows:
     976-1031: Missing.

Show »
Length:1,005
Mass (Da):114,006
Checksum:i79BD8925AA43644F
GO
Isoform 3 (identifier: P59046-3) [UniParc]FASTAAdd to Basket

Also known as: III

The sequence of this isoform differs from the canonical sequence as follows:
     862-973: Missing.

Show »
Length:949
Mass (Da):107,913
Checksum:i99995A1C7261D636
GO
Isoform 4 (identifier: P59046-4) [UniParc]FASTAAdd to Basket

Also known as: IV

The sequence of this isoform differs from the canonical sequence as follows:
     862-1031: Missing.

Show »
Length:891
Mass (Da):101,504
Checksum:i43093A9B22873A00
GO
Isoform 5 (identifier: P59046-5) [UniParc]FASTAAdd to Basket

Also known as: rno-2

The sequence of this isoform differs from the canonical sequence as follows:
     1-717: Missing.
     718-748: LSLYRNALGSRGVKLLCQGLRHPNCKLQNLR → MSQAWWHTSVSPATQEAKAGGLLQPRRQRLW
     921-977: Missing.

Show »
Length:287
Mass (Da):31,765
Checksum:iBD3816C3255B2F9E
GO
Isoform 6 (identifier: P59046-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     920-976: Missing.

Note: No experimental confirmation available.

Show »
Length:1,004
Mass (Da):113,876
Checksum:i7D7350A83F286749
GO
Isoform 7 (identifier: P59046-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     691-691: L → LR

Note: No experimental confirmation.

Show »
Length:1,062
Mass (Da):120,329
Checksum:i0AB81C87F116497F
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti648 – 6481M → T in BAG53059. (PubMed:14702039)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti39 – 391G → V.
Corresponds to variant rs34436714 [ dbSNP | Ensembl ].
VAR_053620
Natural varianti402 – 4021F → L.
Corresponds to variant rs34971363 [ dbSNP | Ensembl ].
VAR_053621

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 717717Missing in isoform 5. 1 PublicationVSP_016908Add
BLAST
Alternative sequencei691 – 6911L → LR in isoform 7. 1 PublicationVSP_055193
Alternative sequencei718 – 74831LSLYR…LQNLR → MSQAWWHTSVSPATQEAKAG GLLQPRRQRLW in isoform 5. 1 PublicationVSP_016909Add
BLAST
Alternative sequencei862 – 1031170Missing in isoform 4. 1 PublicationVSP_009879Add
BLAST
Alternative sequencei862 – 973112Missing in isoform 3. 1 PublicationVSP_005523Add
BLAST
Alternative sequencei920 – 97657Missing in isoform 6. 1 PublicationVSP_054622Add
BLAST
Alternative sequencei921 – 97757Missing in isoform 5. 1 PublicationVSP_016910Add
BLAST
Alternative sequencei976 – 103156Missing in isoform 2. 1 PublicationVSP_005524Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY095146 mRNA. Translation: AAM18227.1.
AY154467 mRNA. Translation: AAO18163.1.
AY116204 mRNA. Translation: AAM75142.1.
AY116205 mRNA. Translation: AAM75143.1.
AY116206 mRNA. Translation: AAM75144.1.
AY116207 mRNA. Translation: AAM75145.1.
AF231021 mRNA. Translation: AAK14942.1.
AK095460 mRNA. Translation: BAG53059.1.
AC008753 Genomic DNA. No translation available.
CH471135 Genomic DNA. Translation: EAW72152.1.
BC028069 mRNA. Translation: AAH28069.1.
CCDSiCCDS12864.1. [P59046-1]
CCDS62784.1. [P59046-6]
CCDS62785.1. [P59046-7]
RefSeqiNP_001264055.1. NM_001277126.1. [P59046-7]
NP_001264058.1. NM_001277129.1. [P59046-6]
NP_653288.1. NM_144687.3. [P59046-1]
UniGeneiHs.631573.

Genome annotation databases

EnsembliENST00000324134; ENSP00000319377; ENSG00000142405. [P59046-1]
ENST00000345770; ENSP00000341428; ENSG00000142405.
ENST00000391772; ENSP00000375652; ENSG00000142405.
ENST00000391773; ENSP00000375653; ENSG00000142405. [P59046-7]
ENST00000391775; ENSP00000375655; ENSG00000142405. [P59046-6]
GeneIDi91662.
KEGGihsa:91662.
UCSCiuc002qch.5. human. [P59046-1]
uc002qci.5. human.
uc010eqw.4. human. [P59046-5]

Polymorphism databases

DMDMi34223733.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY095146 mRNA. Translation: AAM18227.1 .
AY154467 mRNA. Translation: AAO18163.1 .
AY116204 mRNA. Translation: AAM75142.1 .
AY116205 mRNA. Translation: AAM75143.1 .
AY116206 mRNA. Translation: AAM75144.1 .
AY116207 mRNA. Translation: AAM75145.1 .
AF231021 mRNA. Translation: AAK14942.1 .
AK095460 mRNA. Translation: BAG53059.1 .
AC008753 Genomic DNA. No translation available.
CH471135 Genomic DNA. Translation: EAW72152.1 .
BC028069 mRNA. Translation: AAH28069.1 .
CCDSi CCDS12864.1. [P59046-1 ]
CCDS62784.1. [P59046-6 ]
CCDS62785.1. [P59046-7 ]
RefSeqi NP_001264055.1. NM_001277126.1. [P59046-7 ]
NP_001264058.1. NM_001277129.1. [P59046-6 ]
NP_653288.1. NM_144687.3. [P59046-1 ]
UniGenei Hs.631573.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2L6A NMR - A 1-98 [» ]
ProteinModelPortali P59046.
SMRi P59046. Positions 1-98, 209-234, 632-1059.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 124861. 6 interactions.
IntActi P59046. 23 interactions.
MINTi MINT-237788.
STRINGi 9606.ENSP00000319377.

PTM databases

PhosphoSitei P59046.

Polymorphism databases

DMDMi 34223733.

Proteomic databases

PaxDbi P59046.
PRIDEi P59046.

Protocols and materials databases

DNASUi 91662.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000324134 ; ENSP00000319377 ; ENSG00000142405 . [P59046-1 ]
ENST00000345770 ; ENSP00000341428 ; ENSG00000142405 .
ENST00000391772 ; ENSP00000375652 ; ENSG00000142405 .
ENST00000391773 ; ENSP00000375653 ; ENSG00000142405 . [P59046-7 ]
ENST00000391775 ; ENSP00000375655 ; ENSG00000142405 . [P59046-6 ]
GeneIDi 91662.
KEGGi hsa:91662.
UCSCi uc002qch.5. human. [P59046-1 ]
uc002qci.5. human.
uc010eqw.4. human. [P59046-5 ]

Organism-specific databases

CTDi 91662.
GeneCardsi GC19M054296.
HGNCi HGNC:22938. NLRP12.
HPAi HPA042981.
MIMi 609648. gene.
611762. phenotype.
neXtProti NX_P59046.
Orphaneti 247868. NLRP12-associated hereditary periodic fever syndrome.
PharmGKBi PA162397866.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG82860.
GeneTreei ENSGT00770000120466.
HOGENOMi HOG000294064.
HOVERGENi HBG063656.
InParanoidi P59046.
OrthoDBi EOG7P5T07.
PhylomeDBi P59046.
TreeFami TF340267.

Miscellaneous databases

EvolutionaryTracei P59046.
GeneWikii NLRP12.
GenomeRNAii 91662.
NextBioi 35464860.
PROi P59046.
SOURCEi Search...

Gene expression databases

Bgeei P59046.
CleanExi HS_NLRP12.
ExpressionAtlasi P59046. baseline and differential.
Genevestigatori P59046.

Family and domain databases

Gene3Di 1.10.533.10. 1 hit.
InterProi IPR004020. DAPIN.
IPR011029. DEATH-like_dom.
IPR001611. Leu-rich_rpt.
IPR007111. NACHT_NTPase.
IPR029495. NATCH-assoc.
IPR027417. P-loop_NTPase.
[Graphical view ]
Pfami PF14484. FISNA. 1 hit.
PF02758. PYRIN. 1 hit.
[Graphical view ]
SUPFAMi SSF47986. SSF47986. 1 hit.
SSF52540. SSF52540. 1 hit.
PROSITEi PS50824. DAPIN. 1 hit.
PS51450. LRR. 5 hits.
PS50837. NACHT. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "PYPAF7, a novel PYRIN-containing Apaf1-like protein that regulates activation of NF-kappa B and caspase-1-dependent cytokine processing."
    Wang L., Manji G.A., Grenier J.M., Al-Garawi A., Merriam S., Lora J.M., Geddes B.J., Briskin M., DiStefano P.S., Bertin J.
    J. Biol. Chem. 277:29874-29880(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "NALPs: a novel protein family involved in inflammation."
    Tschopp J., Martinon F., Burns K.
    Nat. Rev. Mol. Cell Biol. 4:95-104(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  3. Williams K.L., Linhoff M.W., Harton J.A., Ting J.P.Y.
    Submitted (MAY-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4 AND 7).
    Tissue: Lymphoma.
  4. "Identification and characterization of a novel gene that is upregulated in leukaemia cells by nitric oxide."
    Shami P.J., Kanai N., Wang L.Y., Vreeke T.M., Parker C.J.
    Br. J. Haematol. 112:138-147(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), TISSUE SPECIFICITY, ALTERNATIVE SPLICING, INDUCTION.
    Tissue: Peripheral blood leukocyte.
  5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
  6. "The DNA sequence and biology of human chromosome 19."
    Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
    , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
    Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Leukocyte.
  9. "ATP binding by monarch-1/NLRP12 is critical for its inhibitory function."
    Ye Z., Lich J.D., Moore C.B., Duncan J.A., Williams K.L., Ting J.P.
    Mol. Cell. Biol. 28:1841-1850(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: ATP-BINDING.
  10. Cited for: INVOLVEMENT IN FCAS2.
  11. "The NLRP12 pyrin domain: structure, dynamics, and functional insights."
    Pinheiro A.S., Eibl C., Ekman-Vural Z., Schwarzenbacher R., Peti W.
    J. Mol. Biol. 413:790-803(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: STRUCTURE BY NMR OF 1-98, INTERACTION WITH FAF1.

Entry informationi

Entry nameiNAL12_HUMAN
AccessioniPrimary (citable) accession number: P59046
Secondary accession number(s): A8MTQ2
, B3KTE7, Q8NEU4, Q9BY26
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 19, 2002
Last sequence update: August 22, 2003
Last modified: November 26, 2014
This is version 124 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3