P59046 (NAL12_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 108.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: NACHT, LRR and PYD domains-containing protein 12 Alternative name(s): Monarch-1 PYRIN-containing APAF1-like protein 7 Regulated by nitric oxide | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1061 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May mediate activation of CASP1 via ASC and promote activation of NF-kappa-B via IKK. |
| Subunit structure | Binds to ASC with its DAPIN domain. Interacts with FAF1 UBA domain via its DAPIN domain. Ref.8 |
| Subcellular location | |
| Tissue specificity | Detected only in peripheral blood leukocytes, predominantly in eosinophils and granulocytes, and at lower levels in monocytes. Ref.4 |
| Induction | By nitric oxide and DMSO in HL-60 cells, an acute myeloid leukemia cell line. Ref.4 |
| Involvement in disease | Familial cold autoinflammatory syndrome 2 (FCAS2) [MIM:611762]: A rare autosomal dominant systemic inflammatory disease characterized by recurrent episodes of maculopapular rash associated with arthralgias, myalgias, fever and chills, swelling of the extremities, and conjunctivitis after generalized exposure to cold. |
| Sequence similarities | Belongs to the NLRP family. Contains 1 DAPIN domain. Contains 8 LRR (leucine-rich) repeats. Contains 1 NACHT domain. |
Ontologies
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P59046-1) Also known as: I; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P59046-2) Also known as: II; The sequence of this isoform differs from the canonical sequence as follows: 976-1031: Missing. | ||||||
| Isoform 3 (identifier: P59046-3) Also known as: III; The sequence of this isoform differs from the canonical sequence as follows: 862-973: Missing. | ||||||
| Isoform 4 (identifier: P59046-4) Also known as: IV; The sequence of this isoform differs from the canonical sequence as follows: 862-1031: Missing. | ||||||
| Isoform 5 (identifier: P59046-5) Also known as: rno-2; The sequence of this isoform differs from the canonical sequence as follows: 1-717: Missing. 718-748: LSLYRNALGSRGVKLLCQGLRHPNCKLQNLR → MSQAWWHTSVSPATQEAKAGGLLQPRRQRLW 921-977: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1061 | 1061 | NACHT, LRR and PYD domains-containing protein 12 | PRO_0000080899 | ||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||
| Domain | 1 – 95 | 95 | DAPIN | |||||||||||||||||||||||
| Domain | 211 – 528 | 318 | NACHT | |||||||||||||||||||||||
| Repeat | 828 – 848 | 21 | LRR 1 | |||||||||||||||||||||||
| Repeat | 857 – 878 | 22 | LRR 2 | |||||||||||||||||||||||
| Repeat | 885 – 906 | 22 | LRR 3 | |||||||||||||||||||||||
| Repeat | 914 – 935 | 22 | LRR 4 | |||||||||||||||||||||||
| Repeat | 942 – 962 | 21 | LRR 5 | |||||||||||||||||||||||
| Repeat | 971 – 992 | 22 | LRR 6 | |||||||||||||||||||||||
| Repeat | 999 – 1020 | 22 | LRR 7 | |||||||||||||||||||||||
| Repeat | 1028 – 1049 | 22 | LRR 8 | |||||||||||||||||||||||
| Nucleotide binding | 217 – 224 | 8 | ATP | |||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||
| Alternative sequence | 1 – 717 | 717 | Missing in isoform 5. | VSP_016908 | ||||||||||||||||||||||
| Alternative sequence | 718 – 748 | 31 | LSLYR…LQNLR → MSQAWWHTSVSPATQEAKAG GLLQPRRQRLW in isoform 5. | VSP_016909 | ||||||||||||||||||||||
| Alternative sequence | 862 – 1031 | 170 | Missing in isoform 4. | VSP_009879 | ||||||||||||||||||||||
| Alternative sequence | 862 – 973 | 112 | Missing in isoform 3. | VSP_005523 | ||||||||||||||||||||||
| Alternative sequence | 921 – 977 | 57 | Missing in isoform 5. | VSP_016910 | ||||||||||||||||||||||
| Alternative sequence | 976 – 1031 | 56 | Missing in isoform 2. | VSP_005524 | ||||||||||||||||||||||
| Natural variant | 39 | 1 | G → V. Corresponds to variant rs34436714 [ dbSNP | Ensembl ]. | VAR_053620 | ||||||||||||||||||||||
| Natural variant | 402 | 1 | F → L. Corresponds to variant rs34971363 [ dbSNP | Ensembl ]. | VAR_053621 | ||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||
| Sequence conflict | 691 | 1 | L → LR in AAM75142. Ref.3 | |||||||||||||||||||||||
| Sequence conflict | 691 | 1 | L → LR in AAM75143. Ref.3 | |||||||||||||||||||||||
| Sequence conflict | 691 | 1 | L → LR in AAM75144. Ref.3 | |||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||
| Helix | 10 – 17 | 8 | ||||||||||||||||||||||||
| Helix | 22 – 33 | 12 | ||||||||||||||||||||||||
| Turn | 37 – 40 | 4 | ||||||||||||||||||||||||
| Turn | 47 – 50 | 4 | ||||||||||||||||||||||||
| Helix | 53 – 63 | 11 | ||||||||||||||||||||||||
| Helix | 66 – 77 | 12 | ||||||||||||||||||||||||
| Helix | 78 – 80 | 3 | ||||||||||||||||||||||||
| Helix | 83 – 87 | 5 | ||||||||||||||||||||||||
| Beta strand | 95 – 98 | 4 | ||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "PYPAF7, a novel PYRIN-containing Apaf1-like protein that regulates activation of NF-kappa B and caspase-1-dependent cytokine processing." Wang L., Manji G.A., Grenier J.M., Al-Garawi A., Merriam S., Lora J.M., Geddes B.J., Briskin M., DiStefano P.S., Bertin J. J. Biol. Chem. 277:29874-29880(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "NALPs: a novel protein family involved in inflammation." Tschopp J., Martinon F., Burns K. Nat. Rev. Mol. Cell Biol. 4:95-104(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | Williams K.L., Linhoff M.W., Harton J.A., Ting J.P.Y. Submitted (MAY-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4). Tissue: Lymphoma. |
| [4] | "Identification and characterization of a novel gene that is upregulated in leukaemia cells by nitric oxide." Shami P.J., Kanai N., Wang L.Y., Vreeke T.M., Parker C.J. Br. J. Haematol. 112:138-147(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), TISSUE SPECIFICITY, ALTERNATIVE SPLICING, INDUCTION. Tissue: Peripheral blood leukocyte. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Leukocyte. |
| [6] | "ATP binding by monarch-1/NLRP12 is critical for its inhibitory function." Ye Z., Lich J.D., Moore C.B., Duncan J.A., Williams K.L., Ting J.P. Mol. Cell. Biol. 28:1841-1850(2008) [PubMed] [Europe PMC] [Abstract] Cited for: ATP-BINDING. |
| [7] | "Mutations in NALP12 cause hereditary periodic fever syndromes." Jeru I., Duquesnoy P., Fernandes-Alnemri T., Cochet E., Yu J.W., Lackmy-Port-Lis M., Grimprel E., Landman-Parker J., Hentgen V., Marlin S., McElreavey K., Sarkisian T., Grateau G., Alnemri E.S., Amselem S. Proc. Natl. Acad. Sci. U.S.A. 105:1614-1619(2008) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN FCAS2. |
| [8] | "The NLRP12 pyrin domain: structure, dynamics, and functional insights." Pinheiro A.S., Eibl C., Ekman-Vural Z., Schwarzenbacher R., Peti W. J. Mol. Biol. 413:790-803(2011) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 1-98, INTERACTION WITH FAF1. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AY095146 mRNA. Translation: AAM18227.1. AY154467 mRNA. Translation: AAO18163.1. AY116204 mRNA. Translation: AAM75142.1. AY116205 mRNA. Translation: AAM75143.1. AY116206 mRNA. Translation: AAM75144.1. AY116207 mRNA. Translation: AAM75145.1. AF231021 mRNA. Translation: AAK14942.1. BC028069 mRNA. Translation: AAH28069.1. | ||||||||||||
| IPI | IPI00020916. IPI00221203. IPI00221204. IPI00306878. IPI00413241. | ||||||||||||
| RefSeq | NP_001264055.1. NM_001277126.1. NP_150639.1. NM_033297.2. NP_653288.1. NM_144687.3. | ||||||||||||
| UniGene | Hs.631573. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | P59046. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | P59046. 1 interaction. | ||||||||||||
| STRING | 9606.ENSP00000319377. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | P59046. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 34223733. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | P59046. | ||||||||||||
| PRIDE | P59046. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 91662. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000324134; ENSP00000319377; ENSG00000142405. ENST00000358661; ENSP00000351487; ENSG00000142405. ENST00000391772; ENSP00000375652; ENSG00000142405. ENST00000391773; ENSP00000375653; ENSG00000142405. | ||||||||||||
| GeneID | 91662. | ||||||||||||
| KEGG | hsa:91662. | ||||||||||||
| UCSC | uc002qch.4. human. uc010eqw.3. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 91662. | ||||||||||||
| GeneCards | GC19M054296. | ||||||||||||
| HGNC | HGNC:22938. NLRP12. | ||||||||||||
| HPA | HPA042981. | ||||||||||||
| MIM | 609648. gene. 611762. phenotype. | ||||||||||||
| neXtProt | NX_P59046. | ||||||||||||
| Orphanet | 247868. NALP12-associated hereditary periodic fever syndrome. | ||||||||||||
| PharmGKB | PA162397866. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG82860. | ||||||||||||
| HOGENOM | HOG000294064. | ||||||||||||
| HOVERGEN | HBG063656. | ||||||||||||
| OrthoDB | EOG4TTGHK. | ||||||||||||
| PhylomeDB | P59046. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | P59046. | ||||||||||||
| Bgee | P59046. | ||||||||||||
| CleanEx | HS_NLRP12. | ||||||||||||
| Genevestigator | P59046. | ||||||||||||
| GermOnline | ENSG00000142405. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 1.10.533.10. 1 hit. | ||||||||||||
| InterPro | IPR004020. DAPIN. IPR011029. DEATH-like_dom. IPR001611. Leu-rich_rpt. IPR007111. NACHT_NTPase. [Graphical view] | ||||||||||||
| Pfam | PF02758. PYRIN. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF47986. DEATH_like. 1 hit. | ||||||||||||
| PROSITE | PS50824. DAPIN. 1 hit. PS51450. LRR. 5 hits. PS50837. NACHT. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| EvolutionaryTrace | P59046. | ||||||||||||
| GenomeRNAi | 91662. | ||||||||||||
| NextBio | 77368. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | NAL12_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P59046 Secondary accession number(s): Q8NEU4, Q9BY26 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 19 Human chromosome 19: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
