SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P59046

- NAL12_HUMAN

UniProt

P59046 - NAL12_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
NACHT, LRR and PYD domains-containing protein 12
Gene
NLRP12, NALP12, PYPAF7, RNO
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

May mediate activation of CASP1 via ASC and promote activation of NF-kappa-B via IKK.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi217 – 2248ATP

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. cysteine-type endopeptidase activator activity involved in apoptotic process Source: UniProtKB
  3. protein binding Source: UniProtKB

GO - Biological processi

  1. activation of cysteine-type endopeptidase activity involved in apoptotic process Source: UniProtKB
  2. cellular response to cytokine stimulus Source: Ensembl
  3. dendritic cell migration Source: Ensembl
  4. negative regulation of ERK1 and ERK2 cascade Source: Ensembl
  5. negative regulation of I-kappaB kinase/NF-kappaB signaling Source: HGNC
  6. negative regulation of NF-kappaB transcription factor activity Source: BHF-UCL
  7. negative regulation of NIK/NF-kappaB signaling Source: Ensembl
  8. negative regulation of Toll signaling pathway Source: HGNC
  9. negative regulation of cytokine secretion Source: HGNC
  10. negative regulation of inflammatory response Source: BHF-UCL
  11. negative regulation of interleukin-1 secretion Source: HGNC
  12. negative regulation of interleukin-6 biosynthetic process Source: HGNC
  13. negative regulation of protein autophosphorylation Source: HGNC
  14. negative regulation of signal transduction Source: HGNC
  15. positive regulation of MHC class I biosynthetic process Source: MGI
  16. positive regulation of inflammatory response Source: UniProtKB
  17. positive regulation of interleukin-1 beta secretion Source: UniProtKB
  18. regulation of I-kappaB kinase/NF-kappaB signaling Source: MGI
  19. regulation of cysteine-type endopeptidase activity involved in apoptotic process Source: MGI
  20. regulation of interleukin-18 biosynthetic process Source: UniProtKB
  21. release of cytoplasmic sequestered NF-kappaB Source: UniProtKB
  22. signal transduction Source: UniProtKB
Complete GO annotation...

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
NACHT, LRR and PYD domains-containing protein 12
Alternative name(s):
Monarch-1
PYRIN-containing APAF1-like protein 7
Regulated by nitric oxide
Gene namesi
Name:NLRP12
Synonyms:NALP12, PYPAF7, RNO
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 19

Organism-specific databases

HGNCiHGNC:22938. NLRP12.

Subcellular locationi

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Involvement in diseasei

Familial cold autoinflammatory syndrome 2 (FCAS2) [MIM:611762]: A rare autosomal dominant systemic inflammatory disease characterized by recurrent episodes of maculopapular rash associated with arthralgias, myalgias, fever and chills, swelling of the extremities, and conjunctivitis after generalized exposure to cold.
Note: The disease is caused by mutations affecting the gene represented in this entry.1 Publication

Organism-specific databases

MIMi611762. phenotype.
Orphaneti247868. NLRP12-associated hereditary periodic fever syndrome.
PharmGKBiPA162397866.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10611061NACHT, LRR and PYD domains-containing protein 12
PRO_0000080899Add
BLAST

Proteomic databases

PaxDbiP59046.
PRIDEiP59046.

PTM databases

PhosphoSiteiP59046.

Expressioni

Tissue specificityi

Detected only in peripheral blood leukocytes, predominantly in eosinophils and granulocytes, and at lower levels in monocytes.1 Publication

Inductioni

By nitric oxide and DMSO in HL-60 cells, an acute myeloid leukemia cell line.1 Publication

Gene expression databases

ArrayExpressiP59046.
BgeeiP59046.
CleanExiHS_NLRP12.
GenevestigatoriP59046.

Organism-specific databases

HPAiHPA042981.

Interactioni

Subunit structurei

Binds to ASC with its DAPIN domain. Interacts with FAF1 UBA domain via its DAPIN domain.1 Publication

Protein-protein interaction databases

BioGridi124861. 6 interactions.
IntActiP59046. 2 interactions.
MINTiMINT-237788.
STRINGi9606.ENSP00000319377.

Structurei

Secondary structure

Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi10 – 178
Helixi22 – 3312
Turni37 – 404
Turni47 – 504
Helixi53 – 6311
Helixi66 – 7712
Helixi78 – 803
Helixi83 – 875
Beta strandi95 – 984

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2L6ANMR-A1-98[»]
ProteinModelPortaliP59046.
SMRiP59046. Positions 1-98, 208-233, 633-1059.

Miscellaneous databases

EvolutionaryTraceiP59046.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini1 – 9595DAPIN
Add
BLAST
Domaini211 – 528318NACHT
Add
BLAST
Repeati828 – 84821LRR 1
Add
BLAST
Repeati857 – 87822LRR 2
Add
BLAST
Repeati885 – 90622LRR 3
Add
BLAST
Repeati914 – 93522LRR 4
Add
BLAST
Repeati942 – 96221LRR 5
Add
BLAST
Repeati971 – 99222LRR 6
Add
BLAST
Repeati999 – 102022LRR 7
Add
BLAST
Repeati1028 – 104922LRR 8
Add
BLAST

Sequence similaritiesi

Belongs to the NLRP family.
Contains 1 DAPIN domain.
Contains 1 NACHT domain.

Keywords - Domaini

Leucine-rich repeat, Repeat

Phylogenomic databases

eggNOGiNOG82860.
HOGENOMiHOG000294064.
HOVERGENiHBG063656.
OrthoDBiEOG7P5T07.
PhylomeDBiP59046.
TreeFamiTF340267.

Family and domain databases

Gene3Di1.10.533.10. 1 hit.
InterProiIPR004020. DAPIN.
IPR011029. DEATH-like_dom.
IPR001611. Leu-rich_rpt.
IPR007111. NACHT_NTPase.
IPR029495. NATCH-assoc.
IPR027417. P-loop_NTPase.
[Graphical view]
PfamiPF14484. FISNA. 1 hit.
PF02758. PYRIN. 1 hit.
[Graphical view]
SUPFAMiSSF47986. SSF47986. 1 hit.
SSF52540. SSF52540. 1 hit.
PROSITEiPS50824. DAPIN. 1 hit.
PS51450. LRR. 5 hits.
PS50837. NACHT. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P59046-1) [UniParc]FASTAAdd to Basket

Also known as: I

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MLRTAGRDGL CRLSTYLEEL EAVELKKFKL YLGTATELGE GKIPWGSMEK     50
AGPLEMAQLL ITHFGPEEAW RLALSTFERI NRKDLWERGQ REDLVRDTPP 100
GGPSSLGNQS TCLLEVSLVT PRKDPQETYR DYVRRKFRLM EDRNARLGEC 150
VNLSHRYTRL LLVKEHSNPM QVQQQLLDTG RGHARTVGHQ ASPIKIETLF 200
EPDEERPEPP RTVVMQGAAG IGKSMLAHKV MLDWADGKLF QGRFDYLFYI 250
NCREMNQSAT ECSMQDLIFS CWPEPSAPLQ ELIRVPERLL FIIDGFDELK 300
PSFHDPQGPW CLCWEEKRPT ELLLNSLIRK KLLPELSLLI TTRPTALEKL 350
HRLLEHPRHV EILGFSEAER KEYFYKYFHN AEQAGQVFNY VRDNEPLFTM 400
CFVPLVCWVV CTCLQQQLEG GGLLRQTSRT TTAVYMLYLL SLMQPKPGAP 450
RLQPPPNQRG LCSLAADGLW NQKILFEEQD LRKHGLDGED VSAFLNMNIF 500
QKDINCERYY SFIHLSFQEF FAAMYYILDE GEGGAGPDQD VTRLLTEYAF 550
SERSFLALTS RFLFGLLNEE TRSHLEKSLC WKVSPHIKMD LLQWIQSKAQ 600
SDGSTLQQGS LEFFSCLYEI QEEEFIQQAL SHFQVIVVSN IASKMEHMVS 650
SFCLKRCRSA QVLHLYGATY SADGEDRARC SAGAHTLLVQ LPERTVLLDA 700
YSEHLAAALC TNPNLIELSL YRNALGSRGV KLLCQGLRHP NCKLQNLRLK 750
RCRISSSACE DLSAALIANK NLTRMDLSGN GVGFPGMMLL CEGLRHPQCR 800
LQMIQLRKCQ LESGACQEMA SVLGTNPHLV ELDLTGNALE DLGLRLLCQG 850
LRHPVCRLRT LWLKICRLTA AACDELASTL SVNQSLRELD LSLNELGDLG 900
VLLLCEGLRH PTCKLQTLRL GICRLGSAAC EGLSVVLQAN HNLRELDLSF 950
NDLGDWGLWL LAEGLQHPAC RLQKLWLDSC GLTAKACENL YFTLGINQTL 1000
TDLYLTNNAL GDTGVRLLCK RLSHPGCKLR VLWLFGMDLN KMTHSRLAAL 1050
RVTKPYLDIG C 1061
Length:1,061
Mass (Da):120,173
Last modified:August 22, 2003 - v2
Checksum:i8C10AFE4907C131B
GO
Isoform 2 (identifier: P59046-2) [UniParc]FASTAAdd to Basket

Also known as: II

The sequence of this isoform differs from the canonical sequence as follows:
     976-1031: Missing.

Show »
Length:1,005
Mass (Da):114,006
Checksum:i79BD8925AA43644F
GO
Isoform 3 (identifier: P59046-3) [UniParc]FASTAAdd to Basket

Also known as: III

The sequence of this isoform differs from the canonical sequence as follows:
     862-973: Missing.

Show »
Length:949
Mass (Da):107,913
Checksum:i99995A1C7261D636
GO
Isoform 4 (identifier: P59046-4) [UniParc]FASTAAdd to Basket

Also known as: IV

The sequence of this isoform differs from the canonical sequence as follows:
     862-1031: Missing.

Show »
Length:891
Mass (Da):101,504
Checksum:i43093A9B22873A00
GO
Isoform 5 (identifier: P59046-5) [UniParc]FASTAAdd to Basket

Also known as: rno-2

The sequence of this isoform differs from the canonical sequence as follows:
     1-717: Missing.
     718-748: LSLYRNALGSRGVKLLCQGLRHPNCKLQNLR → MSQAWWHTSVSPATQEAKAGGLLQPRRQRLW
     921-977: Missing.

Show »
Length:287
Mass (Da):31,765
Checksum:iBD3816C3255B2F9E
GO
Isoform 6 (identifier: P59046-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     920-976: Missing.

Note: No experimental confirmation available.

Show »
Length:1,004
Mass (Da):113,876
Checksum:i7D7350A83F286749
GO
Isoform 7 (identifier: P59046-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     691-691: L → LR

Note: No experimental confirmation.

Show »
Length:1,062
Mass (Da):120,329
Checksum:i0AB81C87F116497F
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti39 – 391G → V.
Corresponds to variant rs34436714 [ dbSNP | Ensembl ].
VAR_053620
Natural varianti402 – 4021F → L.
Corresponds to variant rs34971363 [ dbSNP | Ensembl ].
VAR_053621

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 717717Missing in isoform 5.
VSP_016908Add
BLAST
Alternative sequencei691 – 6911L → LR in isoform 7.
VSP_055193
Alternative sequencei718 – 74831LSLYR…LQNLR → MSQAWWHTSVSPATQEAKAG GLLQPRRQRLW in isoform 5.
VSP_016909Add
BLAST
Alternative sequencei862 – 1031170Missing in isoform 4.
VSP_009879Add
BLAST
Alternative sequencei862 – 973112Missing in isoform 3.
VSP_005523Add
BLAST
Alternative sequencei920 – 97657Missing in isoform 6.
VSP_054622Add
BLAST
Alternative sequencei921 – 97757Missing in isoform 5.
VSP_016910Add
BLAST
Alternative sequencei976 – 103156Missing in isoform 2.
VSP_005524Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti648 – 6481M → T in BAG53059. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY095146 mRNA. Translation: AAM18227.1.
AY154467 mRNA. Translation: AAO18163.1.
AY116204 mRNA. Translation: AAM75142.1.
AY116205 mRNA. Translation: AAM75143.1.
AY116206 mRNA. Translation: AAM75144.1.
AY116207 mRNA. Translation: AAM75145.1.
AF231021 mRNA. Translation: AAK14942.1.
AK095460 mRNA. Translation: BAG53059.1.
AC008753 Genomic DNA. No translation available.
CH471135 Genomic DNA. Translation: EAW72152.1.
BC028069 mRNA. Translation: AAH28069.1.
CCDSiCCDS12864.1. [P59046-1]
CCDS62784.1. [P59046-6]
RefSeqiNP_001264055.1. NM_001277126.1.
NP_001264058.1. NM_001277129.1. [P59046-6]
NP_653288.1. NM_144687.3. [P59046-1]
UniGeneiHs.631573.

Genome annotation databases

EnsembliENST00000324134; ENSP00000319377; ENSG00000142405. [P59046-1]
ENST00000345770; ENSP00000341428; ENSG00000142405.
ENST00000391772; ENSP00000375652; ENSG00000142405.
ENST00000391773; ENSP00000375653; ENSG00000142405.
ENST00000391775; ENSP00000375655; ENSG00000142405.
GeneIDi91662.
KEGGihsa:91662.
UCSCiuc002qch.5. human. [P59046-1]
uc002qci.5. human.
uc010eqw.4. human. [P59046-5]

Polymorphism databases

DMDMi34223733.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY095146 mRNA. Translation: AAM18227.1 .
AY154467 mRNA. Translation: AAO18163.1 .
AY116204 mRNA. Translation: AAM75142.1 .
AY116205 mRNA. Translation: AAM75143.1 .
AY116206 mRNA. Translation: AAM75144.1 .
AY116207 mRNA. Translation: AAM75145.1 .
AF231021 mRNA. Translation: AAK14942.1 .
AK095460 mRNA. Translation: BAG53059.1 .
AC008753 Genomic DNA. No translation available.
CH471135 Genomic DNA. Translation: EAW72152.1 .
BC028069 mRNA. Translation: AAH28069.1 .
CCDSi CCDS12864.1. [P59046-1 ]
CCDS62784.1. [P59046-6 ]
RefSeqi NP_001264055.1. NM_001277126.1.
NP_001264058.1. NM_001277129.1. [P59046-6 ]
NP_653288.1. NM_144687.3. [P59046-1 ]
UniGenei Hs.631573.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2L6A NMR - A 1-98 [» ]
ProteinModelPortali P59046.
SMRi P59046. Positions 1-98, 208-233, 633-1059.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 124861. 6 interactions.
IntActi P59046. 2 interactions.
MINTi MINT-237788.
STRINGi 9606.ENSP00000319377.

PTM databases

PhosphoSitei P59046.

Polymorphism databases

DMDMi 34223733.

Proteomic databases

PaxDbi P59046.
PRIDEi P59046.

Protocols and materials databases

DNASUi 91662.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000324134 ; ENSP00000319377 ; ENSG00000142405 . [P59046-1 ]
ENST00000345770 ; ENSP00000341428 ; ENSG00000142405 .
ENST00000391772 ; ENSP00000375652 ; ENSG00000142405 .
ENST00000391773 ; ENSP00000375653 ; ENSG00000142405 .
ENST00000391775 ; ENSP00000375655 ; ENSG00000142405 .
GeneIDi 91662.
KEGGi hsa:91662.
UCSCi uc002qch.5. human. [P59046-1 ]
uc002qci.5. human.
uc010eqw.4. human. [P59046-5 ]

Organism-specific databases

CTDi 91662.
GeneCardsi GC19M054296.
HGNCi HGNC:22938. NLRP12.
HPAi HPA042981.
MIMi 609648. gene.
611762. phenotype.
neXtProti NX_P59046.
Orphaneti 247868. NLRP12-associated hereditary periodic fever syndrome.
PharmGKBi PA162397866.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG82860.
HOGENOMi HOG000294064.
HOVERGENi HBG063656.
OrthoDBi EOG7P5T07.
PhylomeDBi P59046.
TreeFami TF340267.

Miscellaneous databases

EvolutionaryTracei P59046.
GeneWikii NLRP12.
GenomeRNAii 91662.
NextBioi 35464860.
PROi P59046.
SOURCEi Search...

Gene expression databases

ArrayExpressi P59046.
Bgeei P59046.
CleanExi HS_NLRP12.
Genevestigatori P59046.

Family and domain databases

Gene3Di 1.10.533.10. 1 hit.
InterProi IPR004020. DAPIN.
IPR011029. DEATH-like_dom.
IPR001611. Leu-rich_rpt.
IPR007111. NACHT_NTPase.
IPR029495. NATCH-assoc.
IPR027417. P-loop_NTPase.
[Graphical view ]
Pfami PF14484. FISNA. 1 hit.
PF02758. PYRIN. 1 hit.
[Graphical view ]
SUPFAMi SSF47986. SSF47986. 1 hit.
SSF52540. SSF52540. 1 hit.
PROSITEi PS50824. DAPIN. 1 hit.
PS51450. LRR. 5 hits.
PS50837. NACHT. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "PYPAF7, a novel PYRIN-containing Apaf1-like protein that regulates activation of NF-kappa B and caspase-1-dependent cytokine processing."
    Wang L., Manji G.A., Grenier J.M., Al-Garawi A., Merriam S., Lora J.M., Geddes B.J., Briskin M., DiStefano P.S., Bertin J.
    J. Biol. Chem. 277:29874-29880(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "NALPs: a novel protein family involved in inflammation."
    Tschopp J., Martinon F., Burns K.
    Nat. Rev. Mol. Cell Biol. 4:95-104(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  3. Williams K.L., Linhoff M.W., Harton J.A., Ting J.P.Y.
    Submitted (MAY-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4 AND 7).
    Tissue: Lymphoma.
  4. "Identification and characterization of a novel gene that is upregulated in leukaemia cells by nitric oxide."
    Shami P.J., Kanai N., Wang L.Y., Vreeke T.M., Parker C.J.
    Br. J. Haematol. 112:138-147(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), TISSUE SPECIFICITY, ALTERNATIVE SPLICING, INDUCTION.
    Tissue: Peripheral blood leukocyte.
  5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
  6. "The DNA sequence and biology of human chromosome 19."
    Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
    , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
    Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Leukocyte.
  9. "ATP binding by monarch-1/NLRP12 is critical for its inhibitory function."
    Ye Z., Lich J.D., Moore C.B., Duncan J.A., Williams K.L., Ting J.P.
    Mol. Cell. Biol. 28:1841-1850(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: ATP-BINDING.
  10. Cited for: INVOLVEMENT IN FCAS2.
  11. "The NLRP12 pyrin domain: structure, dynamics, and functional insights."
    Pinheiro A.S., Eibl C., Ekman-Vural Z., Schwarzenbacher R., Peti W.
    J. Mol. Biol. 413:790-803(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: STRUCTURE BY NMR OF 1-98, INTERACTION WITH FAF1.

Entry informationi

Entry nameiNAL12_HUMAN
AccessioniPrimary (citable) accession number: P59046
Secondary accession number(s): A8MTQ2
, B3KTE7, Q8NEU4, Q9BY26
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 19, 2002
Last sequence update: August 22, 2003
Last modified: September 3, 2014
This is version 121 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi