Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

NACHT, LRR and PYD domains-containing protein 11

Gene

NLRP11

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Involved in inflammation.Curated

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi153 – 160ATPPROSITE-ProRule annotation8

GO - Molecular functioni

Keywordsi

LigandATP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
NACHT, LRR and PYD domains-containing protein 11
Alternative name(s):
Nucleotide-binding oligomerization domain protein 17
PAAD-and NACHT domain-containing protein 10
PYRIN-containing APAF1-like protein 6
Gene namesi
Name:NLRP11
Synonyms:NALP11, NOD17, PAN10, PYPAF6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

EuPathDBiHostDB:ENSG00000179873.14
HGNCiHGNC:22945 NLRP11
MIMi609664 gene
neXtProtiNX_P59045

Pathology & Biotechi

Organism-specific databases

DisGeNETi204801
OpenTargetsiENSG00000179873
PharmGKBiPA162397841

Polymorphism and mutation databases

BioMutaiNLRP11
DMDMi288558818

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000808981 – 1033NACHT, LRR and PYD domains-containing protein 11Add BLAST1033

Proteomic databases

PaxDbiP59045
PeptideAtlasiP59045
PRIDEiP59045

PTM databases

iPTMnetiP59045
PhosphoSitePlusiP59045

Expressioni

Gene expression databases

BgeeiENSG00000179873
CleanExiHS_NLRP11
ExpressionAtlasiP59045 baseline and differential
GenevisibleiP59045 HS

Organism-specific databases

HPAiHPA046402

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000409898

Structurei

3D structure databases

ProteinModelPortaliP59045
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini1 – 91PyrinPROSITE-ProRule annotationAdd BLAST91
Domaini147 – 470NACHTPROSITE-ProRule annotationAdd BLAST324
Repeati588 – 611LRR 1Add BLAST24
Repeati632 – 655LRR 2Add BLAST24
Repeati745 – 768LRR 3Add BLAST24
Repeati802 – 827LRR 4Add BLAST26
Repeati859 – 882LRR 5Add BLAST24
Repeati919 – 944LRR 6Add BLAST26

Sequence similaritiesi

Belongs to the NLRP family.Curated

Keywords - Domaini

Leucine-rich repeat, Repeat

Phylogenomic databases

eggNOGiENOG410IKMQ Eukaryota
ENOG410ZRHV LUCA
GeneTreeiENSGT00900000140813
HOGENOMiHOG000294064
HOVERGENiHBG100535
InParanoidiP59045
OMAiYWREICS
OrthoDBiEOG091G01CG
PhylomeDBiP59045

Family and domain databases

Gene3Di3.80.10.10, 1 hit
InterProiView protein in InterPro
IPR020611 Cu2_ascorb_mOase_CS-1
IPR004020 DAPIN
IPR011029 DEATH-like_dom_sf
IPR001611 Leu-rich_rpt
IPR032675 LRR_dom_sf
IPR007111 NACHT_NTPase
PfamiView protein in Pfam
PF13516 LRR_6, 2 hits
PF02758 PYRIN, 1 hit
SMARTiView protein in SMART
SM01289 PYRIN, 1 hit
SUPFAMiSSF47986 SSF47986, 1 hit
PROSITEiView protein in PROSITE
PS50824 DAPIN, 1 hit
PS50837 NACHT, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P59045-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAESDSTDFD LLWYLENLSD KEFQSFKKYL ARKILDFKLP QFPLIQMTKE
60 70 80 90 100
ELANVLPISY EGQYIWNMLF SIFSMMRKED LCRKIIGRRN RNQEACKAVM
110 120 130 140 150
RRKFMLQWES HTFGKFHYKF FRDVSSDVFY ILQLAYDSTS YYSANNLNVF
160 170 180 190 200
LMGERASGKT IVINLAVLRW IKGEMWQNMI SYVVHLTAHE INQMTNSSLA
210 220 230 240 250
ELIAKDWPDG QAPIADILSD PKKLLFILED LDNIRFELNV NESALCSNST
260 270 280 290 300
QKVPIPVLLV SLLKRKMAPG CWFLISSRPT RGNNVKTFLK EVDCCTTLQL
310 320 330 340 350
SNGKREIYFN SFFKDRQRAS AALQLVHEDE ILVGLCRVAI LCWITCTVLK
360 370 380 390 400
RQMDKGRDFQ LCCQTPTDLH AHFLADALTS EAGLTANQYH LGLLKRLCLL
410 420 430 440 450
AAGGLFLSTL NFSGEDLRCV GFTEADVSVL QAANILLPSN THKDRYKFIH
460 470 480 490 500
LNVQEFCTAI AFLMAVPNYL IPSGSREYKE KREQYSDFNQ VFTFIFGLLN
510 520 530 540 550
ANRRKILETS FGYQLPMVDS FKWYSVGYMK HLDRDPEKLT HHMPLFYCLY
560 570 580 590 600
ENREEEFVKT IVDALMEVTV YLQSDKDMMV SLYCLDYCCH LRTLKLSVQR
610 620 630 640 650
IFQNKEPLIR PTASQMKSLV YWREICSLFY TMESLRELHI FDNDLNGISE
660 670 680 690 700
RILSKALEHS SCKLRTLKLS YVSTASGFED LLKALARNRS LTYLSINCTS
710 720 730 740 750
ISLNMFSLLH DILHEPTCQI SHLSLMKCDL RASECEEIAS LLISGGSLRK
760 770 780 790 800
LTLSSNPLRS DGMNILCDAL LHPNCTLISL VLVFCCLTEN CCSALGRVLL
810 820 830 840 850
FSPTLRQLDL CVNRLKNYGV LHVTFPLLFP TCQLEELHLS GCFFSSDICQ
860 870 880 890 900
YIAIVIATNE KLRSLEIGSN KIEDAGMQLL CGGLRHPNCM LVNIGLEECM
910 920 930 940 950
LTSACCRSLA SVLTTNKTLE RLNLLQNHLG NDGVAKLLES LISPDCVLKV
960 970 980 990 1000
VGLPLTGLNT QTQQLLMTVK ERKPSLIFLS ETWSLKEGRE IGVTPASQPG
1010 1020 1030
SIIPNSNLDY MFFKFPRMSA AMRTSNTASR QPL
Length:1,033
Mass (Da):117,779
Last modified:February 9, 2010 - v2
Checksum:iFFC12B960F0B63B6
GO
Isoform 2 (identifier: P59045-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     614-668: SQMKSLVYWREICSLFYTMESLRELHIFDNDLNGISERILSKALEHSSCKLRTLK → R

Note: No experimental confirmation available.
Show »
Length:979
Mass (Da):111,419
Checksum:i36C3B9D42ECDE05D
GO
Isoform 3 (identifier: P59045-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-99: Missing.

Show »
Length:934
Mass (Da):105,915
Checksum:iE2A0DF8882035597
GO

Sequence cautioni

The sequence BAC03490 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti788T → I in BAC03490 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_060212188A → S6 PublicationsCorresponds to variant dbSNP:rs299163Ensembl.1
Natural variantiVAR_062141233N → D. Corresponds to variant dbSNP:rs59244027Ensembl.1
Natural variantiVAR_057710438P → L. Corresponds to variant dbSNP:rs12461110Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0382101 – 99Missing in isoform 3. 1 PublicationAdd BLAST99
Alternative sequenceiVSP_007068614 – 668SQMKS…LRTLK → R in isoform 2. 1 PublicationAdd BLAST55

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY095145 mRNA Translation: AAM14632.1
AY226382 mRNA Translation: AAO59428.1
AY154466 mRNA Translation: AAO18162.1
AY168967 mRNA Translation: AAO12532.1
AY168968 mRNA Translation: AAO12533.1
AC008749 Genomic DNA No translation available.
AC012310 Genomic DNA No translation available.
CH471135 Genomic DNA Translation: EAW72415.1
BC034730 mRNA Translation: AAH34730.1
AK090621 mRNA Translation: BAC03490.1 Different initiation.
CCDSiCCDS12935.1 [P59045-1]
CCDS74458.1 [P59045-3]
RefSeqiNP_001284672.1, NM_001297743.1 [P59045-3]
NP_659444.2, NM_145007.3 [P59045-1]
UniGeneiHs.375039

Genome annotation databases

EnsembliENST00000589093; ENSP00000466285; ENSG00000179873 [P59045-1]
ENST00000589824; ENSP00000468082; ENSG00000179873 [P59045-2]
ENST00000592953; ENSP00000468196; ENSG00000179873 [P59045-3]
GeneIDi204801
KEGGihsa:204801
UCSCiuc002qlz.4 human [P59045-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiNAL11_HUMAN
AccessioniPrimary (citable) accession number: P59045
Secondary accession number(s): C9JSF5
, Q2TV85, Q2TV86, Q53ZZ0, Q8NBF5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 19, 2002
Last sequence update: February 9, 2010
Last modified: March 28, 2018
This is version 143 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health