Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

NACHT, LRR and PYD domains-containing protein 11

Gene

NLRP11

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

Involved in inflammation.Curated

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi153 – 1608ATPPROSITE-ProRule annotation

GO - Molecular functioni

Complete GO annotation...

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
NACHT, LRR and PYD domains-containing protein 11
Alternative name(s):
Nucleotide-binding oligomerization domain protein 17
PAAD-and NACHT domain-containing protein 10
PYRIN-containing APAF1-like protein 6
Gene namesi
Name:NLRP11
Synonyms:NALP11, NOD17, PAN10, PYPAF6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:22945. NLRP11.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162397841.

Polymorphism and mutation databases

BioMutaiNLRP11.
DMDMi288558818.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10331033NACHT, LRR and PYD domains-containing protein 11PRO_0000080898Add
BLAST

Proteomic databases

EPDiP59045.
PaxDbiP59045.
PRIDEiP59045.

PTM databases

iPTMnetiP59045.
PhosphoSiteiP59045.

Expressioni

Gene expression databases

BgeeiP59045.
CleanExiHS_NLRP11.
ExpressionAtlasiP59045. baseline and differential.
GenevisibleiP59045. HS.

Organism-specific databases

HPAiHPA046402.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000409898.

Structurei

3D structure databases

ProteinModelPortaliP59045.
SMRiP59045. Positions 7-89, 534-980.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini1 – 9191PyrinPROSITE-ProRule annotationAdd
BLAST
Domaini147 – 470324NACHTPROSITE-ProRule annotationAdd
BLAST
Repeati588 – 61124LRR 1Add
BLAST
Repeati632 – 65524LRR 2Add
BLAST
Repeati745 – 76824LRR 3Add
BLAST
Repeati802 – 82726LRR 4Add
BLAST
Repeati859 – 88224LRR 5Add
BLAST
Repeati919 – 94426LRR 6Add
BLAST

Sequence similaritiesi

Belongs to the NLRP family.Curated
Contains 6 LRR (leucine-rich) repeats.Curated
Contains 1 NACHT domain.PROSITE-ProRule annotation
Contains 1 pyrin domain.PROSITE-ProRule annotation

Keywords - Domaini

Leucine-rich repeat, Repeat

Phylogenomic databases

eggNOGiENOG410IKMQ. Eukaryota.
ENOG410ZRHV. LUCA.
GeneTreeiENSGT00840000129675.
HOGENOMiHOG000294064.
HOVERGENiHBG100535.
InParanoidiP59045.
OMAiVYWREIC.
OrthoDBiEOG7P5T07.
PhylomeDBiP59045.

Family and domain databases

Gene3Di1.10.533.10. 1 hit.
3.80.10.10. 1 hit.
InterProiIPR020611. Cu2_ascorb_mOase_CS-1.
IPR004020. DAPIN.
IPR011029. DEATH-like_dom.
IPR032675. L_dom-like.
IPR001611. Leu-rich_rpt.
IPR007111. NACHT_NTPase.
[Graphical view]
PfamiPF13516. LRR_6. 2 hits.
PF02758. PYRIN. 1 hit.
[Graphical view]
SMARTiSM01289. PYRIN. 1 hit.
[Graphical view]
SUPFAMiSSF47986. SSF47986. 1 hit.
PROSITEiPS50824. DAPIN. 1 hit.
PS50837. NACHT. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P59045-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAESDSTDFD LLWYLENLSD KEFQSFKKYL ARKILDFKLP QFPLIQMTKE
60 70 80 90 100
ELANVLPISY EGQYIWNMLF SIFSMMRKED LCRKIIGRRN RNQEACKAVM
110 120 130 140 150
RRKFMLQWES HTFGKFHYKF FRDVSSDVFY ILQLAYDSTS YYSANNLNVF
160 170 180 190 200
LMGERASGKT IVINLAVLRW IKGEMWQNMI SYVVHLTAHE INQMTNSSLA
210 220 230 240 250
ELIAKDWPDG QAPIADILSD PKKLLFILED LDNIRFELNV NESALCSNST
260 270 280 290 300
QKVPIPVLLV SLLKRKMAPG CWFLISSRPT RGNNVKTFLK EVDCCTTLQL
310 320 330 340 350
SNGKREIYFN SFFKDRQRAS AALQLVHEDE ILVGLCRVAI LCWITCTVLK
360 370 380 390 400
RQMDKGRDFQ LCCQTPTDLH AHFLADALTS EAGLTANQYH LGLLKRLCLL
410 420 430 440 450
AAGGLFLSTL NFSGEDLRCV GFTEADVSVL QAANILLPSN THKDRYKFIH
460 470 480 490 500
LNVQEFCTAI AFLMAVPNYL IPSGSREYKE KREQYSDFNQ VFTFIFGLLN
510 520 530 540 550
ANRRKILETS FGYQLPMVDS FKWYSVGYMK HLDRDPEKLT HHMPLFYCLY
560 570 580 590 600
ENREEEFVKT IVDALMEVTV YLQSDKDMMV SLYCLDYCCH LRTLKLSVQR
610 620 630 640 650
IFQNKEPLIR PTASQMKSLV YWREICSLFY TMESLRELHI FDNDLNGISE
660 670 680 690 700
RILSKALEHS SCKLRTLKLS YVSTASGFED LLKALARNRS LTYLSINCTS
710 720 730 740 750
ISLNMFSLLH DILHEPTCQI SHLSLMKCDL RASECEEIAS LLISGGSLRK
760 770 780 790 800
LTLSSNPLRS DGMNILCDAL LHPNCTLISL VLVFCCLTEN CCSALGRVLL
810 820 830 840 850
FSPTLRQLDL CVNRLKNYGV LHVTFPLLFP TCQLEELHLS GCFFSSDICQ
860 870 880 890 900
YIAIVIATNE KLRSLEIGSN KIEDAGMQLL CGGLRHPNCM LVNIGLEECM
910 920 930 940 950
LTSACCRSLA SVLTTNKTLE RLNLLQNHLG NDGVAKLLES LISPDCVLKV
960 970 980 990 1000
VGLPLTGLNT QTQQLLMTVK ERKPSLIFLS ETWSLKEGRE IGVTPASQPG
1010 1020 1030
SIIPNSNLDY MFFKFPRMSA AMRTSNTASR QPL
Length:1,033
Mass (Da):117,779
Last modified:February 9, 2010 - v2
Checksum:iFFC12B960F0B63B6
GO
Isoform 2 (identifier: P59045-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     614-668: SQMKSLVYWREICSLFYTMESLRELHIFDNDLNGISERILSKALEHSSCKLRTLK → R

Note: No experimental confirmation available.
Show »
Length:979
Mass (Da):111,419
Checksum:i36C3B9D42ECDE05D
GO
Isoform 3 (identifier: P59045-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-99: Missing.

Show »
Length:934
Mass (Da):105,915
Checksum:iE2A0DF8882035597
GO

Sequence cautioni

The sequence BAC03490.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti788 – 7881T → I in BAC03490 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti188 – 1881A → S.6 Publications
Corresponds to variant rs299163 [ dbSNP | Ensembl ].
VAR_060212
Natural varianti233 – 2331N → D.
Corresponds to variant rs59244027 [ dbSNP | Ensembl ].
VAR_062141
Natural varianti438 – 4381P → L.
Corresponds to variant rs12461110 [ dbSNP | Ensembl ].
VAR_057710

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 9999Missing in isoform 3. 1 PublicationVSP_038210Add
BLAST
Alternative sequencei614 – 66855SQMKS…LRTLK → R in isoform 2. 1 PublicationVSP_007068Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY095145 mRNA. Translation: AAM14632.1.
AY226382 mRNA. Translation: AAO59428.1.
AY154466 mRNA. Translation: AAO18162.1.
AY168967 mRNA. Translation: AAO12532.1.
AY168968 mRNA. Translation: AAO12533.1.
AC008749 Genomic DNA. No translation available.
AC012310 Genomic DNA. No translation available.
CH471135 Genomic DNA. Translation: EAW72415.1.
BC034730 mRNA. Translation: AAH34730.1.
AK090621 mRNA. Translation: BAC03490.1. Different initiation.
CCDSiCCDS12935.1. [P59045-1]
CCDS74458.1. [P59045-3]
RefSeqiNP_001284672.1. NM_001297743.1. [P59045-3]
NP_659444.2. NM_145007.3. [P59045-1]
UniGeneiHs.375039.

Genome annotation databases

EnsembliENST00000589093; ENSP00000466285; ENSG00000179873. [P59045-1]
ENST00000589824; ENSP00000468082; ENSG00000179873. [P59045-2]
ENST00000592953; ENSP00000468196; ENSG00000179873. [P59045-3]
GeneIDi204801.
KEGGihsa:204801.
UCSCiuc002qlz.4. human. [P59045-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY095145 mRNA. Translation: AAM14632.1.
AY226382 mRNA. Translation: AAO59428.1.
AY154466 mRNA. Translation: AAO18162.1.
AY168967 mRNA. Translation: AAO12532.1.
AY168968 mRNA. Translation: AAO12533.1.
AC008749 Genomic DNA. No translation available.
AC012310 Genomic DNA. No translation available.
CH471135 Genomic DNA. Translation: EAW72415.1.
BC034730 mRNA. Translation: AAH34730.1.
AK090621 mRNA. Translation: BAC03490.1. Different initiation.
CCDSiCCDS12935.1. [P59045-1]
CCDS74458.1. [P59045-3]
RefSeqiNP_001284672.1. NM_001297743.1. [P59045-3]
NP_659444.2. NM_145007.3. [P59045-1]
UniGeneiHs.375039.

3D structure databases

ProteinModelPortaliP59045.
SMRiP59045. Positions 7-89, 534-980.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000409898.

PTM databases

iPTMnetiP59045.
PhosphoSiteiP59045.

Polymorphism and mutation databases

BioMutaiNLRP11.
DMDMi288558818.

Proteomic databases

EPDiP59045.
PaxDbiP59045.
PRIDEiP59045.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000589093; ENSP00000466285; ENSG00000179873. [P59045-1]
ENST00000589824; ENSP00000468082; ENSG00000179873. [P59045-2]
ENST00000592953; ENSP00000468196; ENSG00000179873. [P59045-3]
GeneIDi204801.
KEGGihsa:204801.
UCSCiuc002qlz.4. human. [P59045-1]

Organism-specific databases

CTDi204801.
GeneCardsiNLRP11.
H-InvDBHIX0015483.
HGNCiHGNC:22945. NLRP11.
HPAiHPA046402.
MIMi609664. gene.
neXtProtiNX_P59045.
PharmGKBiPA162397841.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IKMQ. Eukaryota.
ENOG410ZRHV. LUCA.
GeneTreeiENSGT00840000129675.
HOGENOMiHOG000294064.
HOVERGENiHBG100535.
InParanoidiP59045.
OMAiVYWREIC.
OrthoDBiEOG7P5T07.
PhylomeDBiP59045.

Miscellaneous databases

ChiTaRSiNLRP11. human.
GeneWikiiNLRP11.
GenomeRNAii204801.
PROiP59045.
SOURCEiSearch...

Gene expression databases

BgeeiP59045.
CleanExiHS_NLRP11.
ExpressionAtlasiP59045. baseline and differential.
GenevisibleiP59045. HS.

Family and domain databases

Gene3Di1.10.533.10. 1 hit.
3.80.10.10. 1 hit.
InterProiIPR020611. Cu2_ascorb_mOase_CS-1.
IPR004020. DAPIN.
IPR011029. DEATH-like_dom.
IPR032675. L_dom-like.
IPR001611. Leu-rich_rpt.
IPR007111. NACHT_NTPase.
[Graphical view]
PfamiPF13516. LRR_6. 2 hits.
PF02758. PYRIN. 1 hit.
[Graphical view]
SMARTiSM01289. PYRIN. 1 hit.
[Graphical view]
SUPFAMiSSF47986. SSF47986. 1 hit.
PROSITEiPS50824. DAPIN. 1 hit.
PS50837. NACHT. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "PYPAF7, a novel PYRIN-containing Apaf1-like protein that regulates activation of NF-kappa B and caspase-1-dependent cytokine processing."
    Wang L., Manji G.A., Grenier J.M., Al-Garawi A., Merriam S., Lora J.M., Geddes B.J., Briskin M., DiStefano P.S., Bertin J.
    J. Biol. Chem. 277:29874-29880(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT SER-188.
  2. "Regulation of cryopyrin/Pypaf1 signaling by pyrin, the familial Mediterranean fever gene product."
    Dowds T.A., Masumoto J., Chen F.F., Ogura Y., Inohara N., Nunez G.
    Biochem. Biophys. Res. Commun. 302:575-580(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT SER-188.
  3. "NALPs: a novel protein family involved in inflammation."
    Tschopp J., Martinon F., Burns K.
    Nat. Rev. Mol. Cell Biol. 4:95-104(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT SER-188.
  4. "PAN10: a novel PAAD-containing protein."
    Stehlik C., Xu F., Stassinopoulos A., Godzik A., Reed J.C.
    Submitted (OCT-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3), VARIANT SER-188.
  5. "The DNA sequence and biology of human chromosome 19."
    Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
    , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
    Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT SER-188.
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT SER-188.
    Tissue: Lymph.
  8. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 365-1033 (ISOFORM 2).
    Tissue: Glial tumor.

Entry informationi

Entry nameiNAL11_HUMAN
AccessioniPrimary (citable) accession number: P59045
Secondary accession number(s): C9JSF5
, Q2TV85, Q2TV86, Q53ZZ0, Q8NBF5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 19, 2002
Last sequence update: February 9, 2010
Last modified: June 8, 2016
This is version 128 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.