Reviewed,
UniProtKB/Swiss-Prot P58753 (TIRAP_HUMAN)
Last modified
January 19, 2010.
Version 78.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Toll/interleukin-1 receptor domain-containing adapter protein Short name=TIR domain-containing adapter protein Alternative name(s): MyD88 adapter-like protein Adaptor protein Wyatt | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 221 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Adapter involved in the TLR4 signaling pathway in the innate immune response. Acts via IRAK2 and TRAF-6, leading to the activation of NF-kappa-B, MAPK1, MAPK3 and JNK, resulting in cytokine secretion and the inflammatory response. |
| Subunit structure | Homodimer. Also forms heterodimers with MyD88. Binds to TLR4 and IRAK2 via their respective TIR domains. Binds to PKR and TBK1. Does not interact with IRAK1, nor TLR9. Ref.10 |
| Subcellular location | Cytoplasm By similarity. |
| Tissue specificity | Highly expressed in liver, kidney, spleen, skeletal muscle and heart. Also detected in peripheral blood leukocytes, lung, placenta, small intestine, thymus, colon and brain. |
| Polymorphism | Genetic variation in TIRAP can influence susceptibility or resistance to invasive pneumococcal disease, bacteremia, malaria and tuberculosi. |
| Sequence similarities | Contains 1 TIR domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Immune response Inflammatory response |
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | I-kappaB kinase/NF-kappaB cascade Inferred from Experiment. Source: Reactome inflammatory responseInferred from electronic annotation. Source: UniProtKB-KW innate immune responseInferred from electronic annotation. Source: InterPro |
| Cellular component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell intrinsic to membraneInferred from electronic annotation. Source: InterPro plasma membraneInferred from Experiment. Source: Reactome |
| Molecular function | protein binding Ref.1 Inferred from physical interaction. Source: IntAct transmembrane receptor activityInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| IRAK2 | O43187 | 1 | EBI-528644,EBI-447733 | |
| MYD88 | Q99836 | 1 | EBI-528644,EBI-447677 | |
| TICAM2 | Q86XR7 | 1 | EBI-528644,EBI-525927 | |
| TLR4 | O00206 | 1 | EBI-528644,EBI-528701 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P58753-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P58753-2) The sequence of this isoform differs from the canonical sequence as follows: 216-221: YLQTLS → CKLLQEGEGERDSATVSDLL | ||||||
| Isoform 3 (identifier: P58753-3) The sequence of this isoform differs from the canonical sequence as follows: 221-221: S → WHLLYHGTPEIGVKLETENPCRASDSHKCDKRYRE |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 221 | 221 | Toll/interleukin-1 receptor domain-containing adapter protein | PRO_0000072547 | |||||
Regions | |||||||||
| Domain | 84 – 221 | 138 | TIR | ||||||
Natural variations | |||||||||
| Alternative sequence | 216 – 221 | 6 | YLQTLS → CKLLQEGEGERDSATVSDLL in isoform 2. | VSP_010765 | |||||
| Alternative sequence | 221 | 1 | S → WHLLYHGTPEIGVKLETENP CRASDSHKCDKRYRE in isoform 3. | VSP_017239 | |||||
| Natural variant | 9 | 1 | A → P: dbSNP rs8177369. Ref.7 | VAR_019143 | |||||
| Natural variant | 13 | 1 | R → W: dbSNP rs8177399. Ref.7 | VAR_019144 | |||||
| Natural variant | 55 | 1 | S → N: dbSNP rs3802813. Ref.1 Ref.6 | VAR_036691 | |||||
| Natural variant | 96 | 1 | D → N: dbSNP rs8177400. Ref.7 | VAR_019145 | |||||
| Natural variant | 180 | 1 | S → L Conferres protection against invasive pneumococcal disease, malaria and tuberculosis; attenuates TLR2 signal transduction. dbSNP rs8177374. Ref.7 Ref.11 | VAR_019146 | |||||
| Natural variant | 197 | 1 | V → I: dbSNP rs7932976. | VAR_061713 | |||||
Experimental info | |||||||||
| Mutagenesis | 125 | 1 | P → H: Abolishes NF-kappa-B activation. Ref.1 Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Mal (MyD88-adapter-like) is required for Toll-like receptor-4 signal transduction." Fitzgerald K.A., Palsson-McDermott E.M., Bowie A.G., Jefferies C.A., Mansell A.S., Brady G., Brint E., Dunne A., Gray P., Harte M.T., McMurray D., Smith D.E., Sims J.E., Bird T.A., O'Neill L.A.J. Nature 413:78-83(2001) [PubMed: 11544529] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), MUTAGENESIS OF PRO-125, VARIANT ASN-55. Tissue: Dendritic cell. |
| [2] | "TIRAP: an adapter molecule in the Toll signaling pathway." Horng T., Barton G.M., Medzhitov R. Nat. Immunol. 2:835-841(2001) [PubMed: 11526399] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), MUTAGENESIS OF PRO-125. |
| [3] | "Characterization and structural analysis of TIR domain-containing adaptor protein Wyatt." Kirk P.B., Pereira J.P., Bazan J.F. Submitted (AUG-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [4] | "Two isoforms of MAL, generated by alternative splicing, are found in humans but not mice." Hardy M.P., O'Neill L.A.J. Submitted (MAR-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [5] | "Natural selection in the TLR-related genes in the course of primate evolution." Nakajima T., Ohtani H., Satta Y., Uno Y., Akari H., Ishida T., Kimura A. Immunogenetics 60:727-735(2008) [PubMed: 18810425] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [6] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ASN-55. Tissue: Trachea. |
| [7] | SeattleSNPs variation discovery resource Submitted (APR-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS PRO-9; TRP-13; ASN-96 AND LEU-180. |
| [8] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Blood. |
| [10] | "Toll/IL-1 receptor domain-containing adaptor inducing IFN-beta (TRIF) associates with TNF receptor-associated factor 6 and TANK-binding kinase 1, and activates two distinct transcription factors, NF-kappa B and IFN-regulatory factor-3, in the Toll-like receptor signaling." Sato S., Sugiyama M., Yamamoto M., Watanabe Y., Kawai T., Takeda K., Akira S. J. Immunol. 171:4304-4310(2003) [PubMed: 14530355] [Abstract] Cited for: INTERACTION WITH TBK1. |
| [11] | "A Mal functional variant is associated with protection against invasive pneumococcal disease, bacteremia, malaria and tuberculosis." Khor C.C., Chapman S.J., Vannberg F.O., Dunne A., Murphy C., Ling E.Y., Frodsham A.J., Walley A.J., Kyrieleis O., Khan A., Aucan C., Segal S., Moore C.E., Knox K., Campbell S.J., Lienhardt C., Scott A., Aaby P. Hill A.V.S.Nat. Genet. 39:523-528(2007) [PubMed: 17322885] [Abstract] Cited for: VARIANT LEU-180, INVOLVEMENT IN SUSCEPTIBILITY TO INFECTIOUS DISEASES. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF406652 mRNA. Translation: AAL01160.1. AF378129 mRNA. Translation: AAL05627.1. AF410783 mRNA. Translation: AAL05036.1. AY576785 mRNA. Translation: AAT90417.1. AY576786 mRNA. Translation: AAT90418.1. AB446477 mRNA. Translation: BAG55254.1. AK124298 mRNA. Translation: BAG54027.1. AY282416 Genomic DNA. Translation: AAP31973.1. CH471065 Genomic DNA. Translation: EAW67687.1. BC032474 mRNA. Translation: AAH32474.1. |
| IPI | IPI00104143. IPI00171090. IPI00718966. |
| RefSeq | NP_001034750.1. NP_683708.1. |
| UniGene | Hs.537126 |
3D structure databases | |
| SMR | P58753. Positions 75-204. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P58753. 5 interactions. |
| STRING | P58753. |
PTM databases | |
| PhosphoSite | P58753. |
Genome annotation databases | |
| Ensembl | ENST00000392679; ENSP00000376446; ENSG00000150455; Homo sapiens. [Genome view] ENST00000392680; ENSP00000376447; ENSG00000150455; Homo sapiens. [Genome view] |
| GeneID | 114609. |
| KEGG | hsa:114609. |
| UCSC | uc001qdm.1. human. |
Organism-specific databases | |
| CTD | 114609. |
| GeneCards | GC11P125658. |
| H-InvDB | HIX0010254. |
| HGNC | HGNC:17192. TIRAP. |
| MIM | 606252. gene. 607948. phenotype. 610799. phenotype. 611162. phenotype. |
| PharmGKB | PA134972842. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG17712. |
| HOVERGEN | P58753. |
| OrthoDB | EOG9QC3RP. |
| PhylomeDB | P58753. |
Enzyme and pathway databases | |
| Reactome | REACT_6900. Signaling in Immune system. REACT_6968. Mal Cascade. |
Gene expression databases | |
| ArrayExpress | P58753. |
| Bgee | P58753. |
| CleanEx | HS_MAL. HS_TIRAP. |
| Genevestigator | P58753. |
| GermOnline | ENSG00000150455. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR017279. Tol-interleuk_rcpt_adapt_Tirap. IPR000157. Toll-Interleukin_rcpt. [Graphical view] |
| Pfam | PF01582. TIR. 1 hit. [Graphical view] |
| PIRSF | PIRSF037750. TIR_Tirap. 1 hit. |
| PROSITE | PS50104. TIR. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 79099. |
| SOURCE | Search... |
Entry information
| Entry name | TIRAP_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P58753 Secondary accession number(s): B3KW65, Q56UI0, Q8N5E5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


