P58753 (TIRAP_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 110.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Toll/interleukin-1 receptor domain-containing adapter protein Short name=TIR domain-containing adapter protein Alternative name(s): Adaptor protein Wyatt MyD88 adapter-like protein Short name=MyD88-2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 221 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Adapter involved in TLR2 and TLR4 signaling pathways in the innate immune response. Acts via IRAK2 and TRAF-6, leading to the activation of NF-kappa-B, MAPK1, MAPK3 and JNK, and resulting in cytokine secretion and the inflammatory response. Positively regulates the production of TNF-alpha and interleukin-6. Ref.13 Ref.14 |
| Subunit structure | Homodimer. Also forms heterodimers with MyD88. Binds to TLR4 and IRAK2 via their respective TIR domains. Binds to BMX, PKR and TBK1. Does not interact with IRAK1, nor TLR9. Ref.11 Ref.13 Ref.14 Ref.16 |
| Subcellular location | Cytoplasm By similarity. |
| Tissue specificity | Highly expressed in liver, kidney, spleen, skeletal muscle and heart. Also detected in peripheral blood leukocytes, lung, placenta, small intestine, thymus, colon and brain. |
| Post-translational modification | Phosphorylated by IRAK1 and IRAK4. Also phosphorylated by BTK. Ref.12 Ref.15 Polyubiquitinated. Polyubiquitination follows phosphorylation by BTK and leads to TIRAP degradation. |
| Polymorphism | Genetic variations in TIRAP may influence susceptibility or resistance to invasive pneumococcal disease [MIM:610799], malaria [MIM:611162], and tuberculosis [MIM:607948]. Genetic variations in TIRAP influence susceptibility or resistance to bacterial invasion of the blood and define the bacteremia susceptibility locus 1 (BACTS1) [MIM:614382]. |
| Sequence similarities | Contains 1 TIR domain. |
| Caution | Variant Leu-180 has been reported to reduce TLR2 signal transduction (Ref.17). In contrast, Ref.14 reports that this variant is fully active and has no effect on signal transduction pathways and cytokine production. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| ARAF | P10398 | 2 | EBI-528644,EBI-365961 | |
| CCDC47 | Q96A33 | 2 | EBI-528644,EBI-720151 | |
| IRAK1 | P51617 | 2 | EBI-528644,EBI-358664 | |
| IRAK2 | O43187 | 2 | EBI-528644,EBI-447733 | |
| IRAK4 | Q9NWZ3 | 2 | EBI-528644,EBI-448378 | |
| LTN1 | O94822 | 2 | EBI-528644,EBI-1044684 | |
| MYD88 | Q99836 | 4 | EBI-528644,EBI-447677 | |
| SAMHD1 | Q9Y3Z3 | 2 | EBI-528644,EBI-1054601 | |
| TLR4 | O00206 | 2 | EBI-528644,EBI-528701 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P58753-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P58753-2) The sequence of this isoform differs from the canonical sequence as follows: 216-221: YLQTLS → CKLLQEGEGERDSATVSDLL | ||||||
| Isoform 3 (identifier: P58753-3) The sequence of this isoform differs from the canonical sequence as follows: 221-221: S → WHLLYHGTPEIGVKLETENPCRASDSHKCDKRYRE |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 221 | 221 | Toll/interleukin-1 receptor domain-containing adapter protein | PRO_0000072547 | |||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||
| Domain | 84 – 221 | 138 | TIR | ||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||
| Disulfide bond | 89 ↔ 134 | Ref.16 | |||||||||||||||||||||||||||||
| Disulfide bond | 142 ↔ 174 | Ref.16 | |||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||
| Alternative sequence | 216 – 221 | 6 | YLQTLS → CKLLQEGEGERDSATVSDLL in isoform 2. | VSP_010765 | |||||||||||||||||||||||||||
| Alternative sequence | 221 | 1 | S → WHLLYHGTPEIGVKLETENP CRASDSHKCDKRYRE in isoform 3. | VSP_017239 | |||||||||||||||||||||||||||
| Natural variant | 9 | 1 | A → P Does not affect NF-kappa-B activation and TNF-alpha production. Ref.7 Ref.14 Corresponds to variant rs8177369 [ dbSNP | Ensembl ]. | VAR_019143 | |||||||||||||||||||||||||||
| Natural variant | 13 | 1 | R → W Does not affect NF-kappa-B activation and TNF-alpha production. Ref.7 Ref.14 Corresponds to variant rs8177399 [ dbSNP | Ensembl ]. | VAR_019144 | |||||||||||||||||||||||||||
| Natural variant | 55 | 1 | S → N Does not affect NF-kappa-B activation and TNF-alpha production. Ref.1 Ref.6 Corresponds to variant rs3802813 [ dbSNP | Ensembl ]. | VAR_036691 | |||||||||||||||||||||||||||
| Natural variant | 96 | 1 | D → N Hypomorphic variant resulting in impaired NF-kappa-B activation and TNF-alpha production; cannot bind MYD88. Ref.7 Ref.14 Corresponds to variant rs8177400 [ dbSNP | Ensembl ]. | VAR_019145 | |||||||||||||||||||||||||||
| Natural variant | 180 | 1 | S → L At heterozygosity it protects against invasive pneumococcal disease, malaria, bacteremia and tuberculosis; does not affect NF-kappa-B activation and TNF-alpha production; attenuates TLR2 signal transduction. Ref.7 Ref.14 Ref.17 Ref.18 Corresponds to variant rs8177374 [ dbSNP | Ensembl ]. | VAR_019146 | |||||||||||||||||||||||||||
| Natural variant | 197 | 1 | V → I Does not affect NF-kappa-B activation and TNF-alpha production. Ref.14 Corresponds to variant rs7932976 [ dbSNP | Ensembl ]. | VAR_061713 | |||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||
| Mutagenesis | 125 | 1 | P → H: Abolishes NF-kappa-B activation. Ref.1 Ref.2 | ||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||
| Beta strand | 83 – 91 | 9 | |||||||||||||||||||||||||||||
| Helix | 94 – 96 | 3 | |||||||||||||||||||||||||||||
| Helix | 97 – 108 | 12 | |||||||||||||||||||||||||||||
| Beta strand | 131 – 133 | 3 | |||||||||||||||||||||||||||||
| Beta strand | 140 – 147 | 8 | |||||||||||||||||||||||||||||
| Helix | 149 – 153 | 5 | |||||||||||||||||||||||||||||
| Helix | 155 – 166 | 12 | |||||||||||||||||||||||||||||
| Beta strand | 168 – 179 | 12 | |||||||||||||||||||||||||||||
| Helix | 184 – 186 | 3 | |||||||||||||||||||||||||||||
| Helix | 189 – 193 | 5 | |||||||||||||||||||||||||||||
| Helix | 202 – 205 | 4 | |||||||||||||||||||||||||||||
| Helix | 206 – 217 | 12 | |||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Mal (MyD88-adapter-like) is required for Toll-like receptor-4 signal transduction." Fitzgerald K.A., Palsson-McDermott E.M., Bowie A.G., Jefferies C.A., Mansell A.S., Brady G., Brint E., Dunne A., Gray P., Harte M.T., McMurray D., Smith D.E., Sims J.E., Bird T.A., O'Neill L.A.J. Nature 413:78-83(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), MUTAGENESIS OF PRO-125, VARIANT ASN-55. Tissue: Dendritic cell. |
| [2] | "TIRAP: an adapter molecule in the Toll signaling pathway." Horng T., Barton G.M., Medzhitov R. Nat. Immunol. 2:835-841(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), MUTAGENESIS OF PRO-125. |
| [3] | "Characterization and structural analysis of TIR domain-containing adaptor protein Wyatt." Kirk P.B., Pereira J.P., Bazan J.F. Submitted (AUG-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [4] | "Two isoforms of MAL, generated by alternative splicing, are found in humans but not mice." Hardy M.P., O'Neill L.A.J. Submitted (MAR-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). |
| [5] | "Natural selection in the TLR-related genes in the course of primate evolution." Nakajima T., Ohtani H., Satta Y., Uno Y., Akari H., Ishida T., Kimura A. Immunogenetics 60:727-735(2008) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [6] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT ASN-55. Tissue: Brain and Trachea. |
| [7] | SeattleSNPs variation discovery resource Submitted (APR-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS PRO-9; TRP-13; ASN-96 AND LEU-180. |
| [8] | "Human chromosome 11 DNA sequence and analysis including novel gene identification." Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. Sakaki Y.Nature 440:497-500(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [10] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Blood. |
| [11] | "Toll/IL-1 receptor domain-containing adaptor inducing IFN-beta (TRIF) associates with TNF receptor-associated factor 6 and TANK-binding kinase 1, and activates two distinct transcription factors, NF-kappa B and IFN-regulatory factor-3, in the Toll-like receptor signaling." Sato S., Sugiyama M., Yamamoto M., Watanabe Y., Kawai T., Takeda K., Akira S. J. Immunol. 171:4304-4310(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH TBK1. |
| [12] | "Suppressor of cytokine signaling 1 negatively regulates Toll-like receptor signaling by mediating Mal degradation." Mansell A., Smith R., Doyle S.L., Gray P., Fenner J.E., Crack P.J., Nicholson S.E., Hilton D.J., O'Neill L.A., Hertzog P.J. Nat. Immunol. 7:148-155(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION BY BTK, UBIQUITINATION. |
| [13] | "Etk/BMX, a Btk family tyrosine kinase, and Mal contribute to the cross-talk between MyD88 and FAK pathways." Semaan N., Alsaleh G., Gottenberg J.E., Wachsmann D., Sibilia J. J. Immunol. 180:3485-3491(2008) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH BMX. |
| [14] | "A TIR domain variant of MyD88 adapter-like (Mal)/TIRAP results in loss of MyD88 binding and reduced TLR2/TLR4 signaling." Nagpal K., Plantinga T.S., Wong J., Monks B.G., Gay N.J., Netea M.G., Fitzgerald K.A., Golenbock D.T. J. Biol. Chem. 284:25742-25748(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH MYD88, VARIANT ASN-96, CHARACTERIZATION OF VARIANTS PRO-9; TRP-13; ASN-96; LEU-180 AND ILE-197. |
| [15] | "IRAK1 and IRAK4 promote phosphorylation, ubiquitination, and degradation of MyD88 adaptor-like (Mal)." Dunne A., Carpenter S., Brikos C., Gray P., Strelow A., Wesche H., Morrice N., O'Neill L.A. J. Biol. Chem. 285:18276-18282(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION BY IRAK1 AND IRAK4. |
| [16] | "Crystal structure of Toll-like receptor adaptor MAL/TIRAP reveals the molecular basis for signal transduction and disease protection." Valkov E., Stamp A., Dimaio F., Baker D., Verstak B., Roversi P., Kellie S., Sweet M.J., Mansell A., Gay N.J., Martin J.L., Kobe B. Proc. Natl. Acad. Sci. U.S.A. 108:14879-14884(2011) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (3.01 ANGSTROMS) OF 79-221, SUBUNIT, DISULFIDE BONDS. |
| [17] | "A Mal functional variant is associated with protection against invasive pneumococcal disease, bacteremia, malaria and tuberculosis." Khor C.C., Chapman S.J., Vannberg F.O., Dunne A., Murphy C., Ling E.Y., Frodsham A.J., Walley A.J., Kyrieleis O., Khan A., Aucan C., Segal S., Moore C.E., Knox K., Campbell S.J., Lienhardt C., Scott A., Aaby P. Hill A.V.S.Nat. Genet. 39:523-528(2007) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT LEU-180, POSSIBLE INVOLVEMENT IN PROTECTION AGAINST INVASIVE PNEUMOCOCCAL DISEASE; BACTEREMIA; MALARIA AND TUBERCULOSIS. |
| [18] | "Low frequency of the TIRAP S180L polymorphism in Africa, and its potential role in malaria, sepsis, and leprosy." Hamann L., Kumpf O., Schuring R.P., Alpsoy E., Bedu-Addo G., Bienzle U., Oskam L., Mockenhaupt F.P., Schumann R.R. BMC Med. Genet. 10:65-65(2009) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT LEU-180. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF406652 mRNA. Translation: AAL01160.1. AF378129 mRNA. Translation: AAL05627.1. AF410783 mRNA. Translation: AAL05036.1. AY576785 mRNA. Translation: AAT90417.1. AY576786 mRNA. Translation: AAT90418.1. AY576787 mRNA. Translation: AAT90419.1. AB446477 mRNA. Translation: BAG55254.1. AK124298 mRNA. Translation: BAG54027.1. AK313147 mRNA. Translation: BAG35965.1. AY282416 Genomic DNA. Translation: AAP31973.1. AP001318 Genomic DNA. No translation available. CH471065 Genomic DNA. Translation: EAW67687.1. CH471065 Genomic DNA. Translation: EAW67689.1. BC032474 mRNA. Translation: AAH32474.1. | ||||||||||||||||||||||||||||||
| IPI | IPI00104143. IPI00171090. IPI00718966. | ||||||||||||||||||||||||||||||
| RefSeq | NP_001034750.1. NM_001039661.1. NP_683708.1. NM_148910.2. | ||||||||||||||||||||||||||||||
| UniGene | Hs.537126. | ||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||
| ProteinModelPortal | P58753. | ||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||
| IntAct | P58753. 24 interactions. | ||||||||||||||||||||||||||||||
| MINT | MINT-4950450. | ||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000376445. | ||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||
| PhosphoSite | P58753. | ||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||
| DMDM | 50403750. | ||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||
| PaxDb | P58753. | ||||||||||||||||||||||||||||||
| PRIDE | P58753. | ||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||
| DNASU | 114609. | ||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||
| Ensembl | ENST00000392678; ENSP00000376445; ENSG00000150455. ENST00000392679; ENSP00000376446; ENSG00000150455. ENST00000392680; ENSP00000376447; ENSG00000150455. ENST00000479770; ENSP00000436967; ENSG00000150455. | ||||||||||||||||||||||||||||||
| GeneID | 114609. | ||||||||||||||||||||||||||||||
| KEGG | hsa:114609. | ||||||||||||||||||||||||||||||
| UCSC | uc001qdm.1. human. | ||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||
| CTD | 114609. | ||||||||||||||||||||||||||||||
| GeneCards | GC11P126153. | ||||||||||||||||||||||||||||||
| HGNC | HGNC:17192. TIRAP. | ||||||||||||||||||||||||||||||
| HPA | HPA054431. | ||||||||||||||||||||||||||||||
| MIM | 606252. gene. 607948. phenotype. 610799. phenotype. 611162. phenotype. 614382. phenotype. | ||||||||||||||||||||||||||||||
| neXtProt | NX_P58753. | ||||||||||||||||||||||||||||||
| PharmGKB | PA134972842. | ||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||
| eggNOG | NOG80263. | ||||||||||||||||||||||||||||||
| HOGENOM | HOG000068972. | ||||||||||||||||||||||||||||||
| HOVERGEN | HBG054203. | ||||||||||||||||||||||||||||||
| KO | K05403. | ||||||||||||||||||||||||||||||
| OrthoDB | EOG4W3SP0. | ||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||
| Reactome | REACT_6900. Immune System. | ||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||
| ArrayExpress | P58753. | ||||||||||||||||||||||||||||||
| Bgee | P58753. | ||||||||||||||||||||||||||||||
| CleanEx | HS_MAL. HS_TIRAP. | ||||||||||||||||||||||||||||||
| Genevestigator | P58753. | ||||||||||||||||||||||||||||||
| GermOnline | ENSG00000150455. Homo sapiens. | ||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||
| InterPro | IPR000157. TIR_dom. IPR017279. Tol-interleuk_rcpt_adapt_Tirap. [Graphical view] | ||||||||||||||||||||||||||||||
| PANTHER | PTHR22662. PTHR22662. 1 hit. | ||||||||||||||||||||||||||||||
| Pfam | PF13676. TIR_2. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||
| PIRSF | PIRSF037750. TIR_Tirap. 1 hit. | ||||||||||||||||||||||||||||||
| SUPFAM | SSF52200. TIR. 1 hit. | ||||||||||||||||||||||||||||||
| PROSITE | PS50104. TIR. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||
| GenomeRNAi | 114609. | ||||||||||||||||||||||||||||||
| NextBio | 79099. | ||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||
Entry information
| Entry name | TIRAP_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P58753 Secondary accession number(s): B3KW65 Q8N5E5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
