Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein FAM3B

Gene

FAM3B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Induces apoptosis of alpha and beta cells in a dose- and time-dependent manner.1 Publication

GO - Molecular functioni

  • cytokine activity Source: UniProtKB

GO - Biological processi

  • apoptotic process Source: UniProtKB-KW
  • insulin secretion Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Cytokine

Keywords - Biological processi

Apoptosis

Names & Taxonomyi

Protein namesi
Recommended name:
Protein FAM3B
Alternative name(s):
Cytokine-like protein 2-21
Pancreatic-derived factor
Short name:
PANDER
Gene namesi
Name:FAM3B
Synonyms:C21orf11, C21orf76
ORF Names:PRED44, UNQ320/PRO365
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 21

Organism-specific databases

HGNCiHGNC:1253. FAM3B.

Subcellular locationi

  • Secreted

  • Note: Present in insulin secretory granules and likely cosecreted with insulin. Localized in discrete vesicular and perinuclear structure.

GO - Cellular componenti

  • extracellular exosome Source: UniProtKB
  • extracellular region Source: UniProtKB
  • extracellular space Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA27979.

Polymorphism and mutation databases

BioMutaiFAM3B.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2929Add
BLAST
Chaini30 – 235206Protein FAM3BPRO_0000008750Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi63 ↔ 91By similarity
Disulfide bondi69 ↔ 229By similarity
Glycosylationi120 – 1201N-linked (GlcNAc...)Sequence analysis
Glycosylationi208 – 2081N-linked (GlcNAc...)Sequence analysis

Post-translational modificationi

2 N-termini have been observed in the mature protein: the first at Glu-30, resulting from signal peptide cleavage, the second at Ser-46.
O-glycosylated.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiP58499.
PeptideAtlasiP58499.
PRIDEiP58499.

PTM databases

iPTMnetiP58499.
PhosphoSiteiP58499.

Expressioni

Tissue specificityi

Highly expressed in the pancreas. Also found in the colon, kidney, prostate, small intestine and testis.1 Publication

Gene expression databases

BgeeiP58499.
CleanExiHS_FAM3B.
ExpressionAtlasiP58499. baseline and differential.
GenevisibleiP58499. HS.

Organism-specific databases

HPAiHPA015885.

Interactioni

GO - Molecular functioni

  • cytokine activity Source: UniProtKB

Protein-protein interaction databases

BioGridi119895. 9 interactions.
STRINGi9606.ENSP00000350673.

Structurei

3D structure databases

ProteinModelPortaliP58499.
SMRiP58499. Positions 58-232.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the FAM3 family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiENOG410IJKD. Eukaryota.
ENOG4111GER. LUCA.
GeneTreeiENSGT00530000063020.
HOGENOMiHOG000285992.
HOVERGENiHBG099991.
InParanoidiP58499.
OrthoDBiEOG79KPG6.
PhylomeDBiP58499.
TreeFamiTF353414.

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform B (identifier: P58499-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRPLAGGLLK VVFVVFASLC AWYSGYLLAE LIPDAPLSSA AYSIRSIGER
60 70 80 90 100
PVLKAPVPKR QKCDHWTPCP SDTYAYRLLS GGGRSKYAKI CFEDNLLMGE
110 120 130 140 150
QLGNVARGIN IAIVNYVTGN VTATRCFDMY EGDNSGPMTK FIQSAAPKSL
160 170 180 190 200
LFMVTYDDGS TRLNNDAKNA IEALGSKEIR NMKFRSSWVF IAAKGLELPS
210 220 230
EIQREKINHS DAKNNRYSGW PAEIQIEGCI PKERS
Length:235
Mass (Da):25,982
Last modified:October 10, 2002 - v2
Checksum:i05B74722D03155FF
GO
Isoform A (identifier: P58499-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     7-7: G → GSRWACWLTRCLISCFDINVQGRLLVKLRPKPTANTTCPG

Show »
Length:274
Mass (Da):30,383
Checksum:i4727D6EC48D2AD7A
GO
Isoform C (identifier: P58499-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     7-54: Missing.

Show »
Length:187
Mass (Da):20,815
Checksum:i49124303689B545F
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti14 – 141V → M.
Corresponds to variant rs2838012 [ dbSNP | Ensembl ].
VAR_021953

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei7 – 5448Missing in isoform C. 1 PublicationVSP_001505Add
BLAST
Alternative sequencei7 – 71G → GSRWACWLTRCLISCFDINV QGRLLVKLRPKPTANTTCPG in isoform A. 1 PublicationVSP_001504

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ409094 mRNA. Translation: CAC83974.1.
AF375989 mRNA. Translation: AAL34495.1.
AY040086 mRNA. Translation: AAK74134.1.
AF494379 mRNA. Translation: AAM94280.1.
AY358459 mRNA. Translation: AAQ88824.1.
BC057829 mRNA. Translation: AAH57829.1.
CCDSiCCDS13671.1. [P58499-1]
CCDS42930.1. [P58499-3]
RefSeqiNP_478066.3. NM_058186.3. [P58499-1]
NP_996847.1. NM_206964.1. [P58499-3]
UniGeneiHs.473877.
Hs.670704.

Genome annotation databases

EnsembliENST00000357985; ENSP00000350673; ENSG00000183844. [P58499-1]
ENST00000398647; ENSP00000381642; ENSG00000183844. [P58499-3]
ENST00000398652; ENSP00000381646; ENSG00000183844. [P58499-2]
GeneIDi54097.
KEGGihsa:54097.
UCSCiuc002yzb.2. human. [P58499-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ409094 mRNA. Translation: CAC83974.1.
AF375989 mRNA. Translation: AAL34495.1.
AY040086 mRNA. Translation: AAK74134.1.
AF494379 mRNA. Translation: AAM94280.1.
AY358459 mRNA. Translation: AAQ88824.1.
BC057829 mRNA. Translation: AAH57829.1.
CCDSiCCDS13671.1. [P58499-1]
CCDS42930.1. [P58499-3]
RefSeqiNP_478066.3. NM_058186.3. [P58499-1]
NP_996847.1. NM_206964.1. [P58499-3]
UniGeneiHs.473877.
Hs.670704.

3D structure databases

ProteinModelPortaliP58499.
SMRiP58499. Positions 58-232.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119895. 9 interactions.
STRINGi9606.ENSP00000350673.

PTM databases

iPTMnetiP58499.
PhosphoSiteiP58499.

Polymorphism and mutation databases

BioMutaiFAM3B.

Proteomic databases

PaxDbiP58499.
PeptideAtlasiP58499.
PRIDEiP58499.

Protocols and materials databases

DNASUi54097.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000357985; ENSP00000350673; ENSG00000183844. [P58499-1]
ENST00000398647; ENSP00000381642; ENSG00000183844. [P58499-3]
ENST00000398652; ENSP00000381646; ENSG00000183844. [P58499-2]
GeneIDi54097.
KEGGihsa:54097.
UCSCiuc002yzb.2. human. [P58499-1]

Organism-specific databases

CTDi54097.
GeneCardsiFAM3B.
HGNCiHGNC:1253. FAM3B.
HPAiHPA015885.
MIMi608617. gene.
neXtProtiNX_P58499.
PharmGKBiPA27979.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IJKD. Eukaryota.
ENOG4111GER. LUCA.
GeneTreeiENSGT00530000063020.
HOGENOMiHOG000285992.
HOVERGENiHBG099991.
InParanoidiP58499.
OrthoDBiEOG79KPG6.
PhylomeDBiP58499.
TreeFamiTF353414.

Miscellaneous databases

GeneWikiiFAM3B.
GenomeRNAii54097.
PROiP58499.
SOURCEiSearch...

Gene expression databases

BgeeiP58499.
CleanExiHS_FAM3B.
ExpressionAtlasiP58499. baseline and differential.
GenevisibleiP58499. HS.

Family and domain databases

ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "From PREDs and open reading frames to cDNA isolation: revisiting the human chromosome 21 transcription map."
    Reymond A., Friedli M., Neergaard Henrichsen C., Chapot F., Deutsch S., Ucla C., Rossier C., Lyle R., Guipponi M., Antonarakis S.E.
    Genomics 78:46-54(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A; B AND C).
  2. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM B), PARTIAL PROTEIN SEQUENCE, CHARACTERIZATION.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM B).
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM B).
    Tissue: Placenta.
  5. "Structure-function studies of PANDER, an islet specific cytokine inducing cell death of insulin-secreting beta cells."
    Yang J., Gao Z., Robert C.E., Burkhardt B.R., Gaweska H., Wagner A., Wu J., Greene S.R., Young R.A., Wolf B.A.
    Biochemistry 44:11342-11352(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, TISSUE SPECIFICITY, DISULFIDE BONDS.

Entry informationi

Entry nameiFAM3B_HUMAN
AccessioniPrimary (citable) accession number: P58499
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 19, 2001
Last sequence update: October 10, 2002
Last modified: July 6, 2016
This is version 122 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 21
    Human chromosome 21: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.