Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein FAM3B

Gene

FAM3B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Induces apoptosis of alpha and beta cells in a dose- and time-dependent manner.1 Publication

GO - Molecular functioni

  • cytokine activity Source: UniProtKB

GO - Biological processi

  • apoptotic process Source: UniProtKB-KW
  • insulin secretion Source: UniProtKB

Keywordsi

Molecular functionCytokine
Biological processApoptosis

Names & Taxonomyi

Protein namesi
Recommended name:
Protein FAM3B
Alternative name(s):
Cytokine-like protein 2-21
Pancreatic-derived factor
Short name:
PANDER
Gene namesi
Name:FAM3B
Synonyms:C21orf11, C21orf76
ORF Names:PRED44, UNQ320/PRO365
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 21

Organism-specific databases

EuPathDBiHostDB:ENSG00000183844.16
HGNCiHGNC:1253 FAM3B
MIMi608617 gene
neXtProtiNX_P58499

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

DisGeNETi54097
OpenTargetsiENSG00000183844
PharmGKBiPA27979

Polymorphism and mutation databases

BioMutaiFAM3B

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 29Add BLAST29
ChainiPRO_000000875030 – 235Protein FAM3BAdd BLAST206

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi63 ↔ 91By similarity
Disulfide bondi69 ↔ 229By similarity
Glycosylationi120N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi208N-linked (GlcNAc...) asparagineSequence analysis1

Post-translational modificationi

2 N-termini have been observed in the mature protein: the first at Glu-30, resulting from signal peptide cleavage, the second at Ser-46.
O-glycosylated.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiP58499
PeptideAtlasiP58499
PRIDEiP58499

PTM databases

iPTMnetiP58499
PhosphoSitePlusiP58499

Expressioni

Tissue specificityi

Highly expressed in the pancreas. Also found in the colon, kidney, prostate, small intestine and testis.1 Publication

Gene expression databases

BgeeiENSG00000183844
CleanExiHS_FAM3B
ExpressionAtlasiP58499 baseline and differential
GenevisibleiP58499 HS

Organism-specific databases

HPAiHPA015885
HPA029777

Interactioni

GO - Molecular functioni

  • cytokine activity Source: UniProtKB

Protein-protein interaction databases

BioGridi119895, 10 interactors
IntActiP58499, 1 interactor
STRINGi9606.ENSP00000350673

Structurei

3D structure databases

ProteinModelPortaliP58499
SMRiP58499
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the FAM3 family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiENOG410IJKD Eukaryota
ENOG4111GER LUCA
GeneTreeiENSGT00530000063020
HOGENOMiHOG000285992
HOVERGENiHBG099991
InParanoidiP58499
OrthoDBiEOG091G0JEF
PhylomeDBiP58499
TreeFamiTF353414

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform B (identifier: P58499-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRPLAGGLLK VVFVVFASLC AWYSGYLLAE LIPDAPLSSA AYSIRSIGER
60 70 80 90 100
PVLKAPVPKR QKCDHWTPCP SDTYAYRLLS GGGRSKYAKI CFEDNLLMGE
110 120 130 140 150
QLGNVARGIN IAIVNYVTGN VTATRCFDMY EGDNSGPMTK FIQSAAPKSL
160 170 180 190 200
LFMVTYDDGS TRLNNDAKNA IEALGSKEIR NMKFRSSWVF IAAKGLELPS
210 220 230
EIQREKINHS DAKNNRYSGW PAEIQIEGCI PKERS
Length:235
Mass (Da):25,982
Last modified:October 10, 2002 - v2
Checksum:i05B74722D03155FF
GO
Isoform A (identifier: P58499-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     7-7: G → GSRWACWLTRCLISCFDINVQGRLLVKLRPKPTANTTCPG

Show »
Length:274
Mass (Da):30,383
Checksum:i4727D6EC48D2AD7A
GO
Isoform C (identifier: P58499-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     7-54: Missing.

Show »
Length:187
Mass (Da):20,815
Checksum:i49124303689B545F
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02195314V → M. Corresponds to variant dbSNP:rs2838012Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0015057 – 54Missing in isoform C. 1 PublicationAdd BLAST48
Alternative sequenceiVSP_0015047G → GSRWACWLTRCLISCFDINV QGRLLVKLRPKPTANTTCPG in isoform A. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ409094 mRNA Translation: CAC83974.1
AF375989 mRNA Translation: AAL34495.1
AY040086 mRNA Translation: AAK74134.1
AF494379 mRNA Translation: AAM94280.1
AY358459 mRNA Translation: AAQ88824.1
BC057829 mRNA Translation: AAH57829.1
CCDSiCCDS13671.1 [P58499-1]
CCDS42930.1 [P58499-3]
RefSeqiNP_478066.3, NM_058186.3 [P58499-1]
NP_996847.1, NM_206964.1 [P58499-3]
UniGeneiHs.473877
Hs.670704

Genome annotation databases

EnsembliENST00000357985; ENSP00000350673; ENSG00000183844 [P58499-1]
ENST00000398647; ENSP00000381642; ENSG00000183844 [P58499-3]
ENST00000398652; ENSP00000381646; ENSG00000183844 [P58499-2]
GeneIDi54097
KEGGihsa:54097
UCSCiuc002yzb.2 human [P58499-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiFAM3B_HUMAN
AccessioniPrimary (citable) accession number: P58499
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 19, 2001
Last sequence update: October 10, 2002
Last modified: February 28, 2018
This is version 131 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 21
    Human chromosome 21: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health