P58499 (FAM3B_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 89.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Protein FAM3B Alternative name(s): Cytokine-like protein 2-21 Pancreatic-derived factor Short name=PANDER | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 235 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Induces apoptosis of alpha and beta cells in a dose- and time-dependent manner. Present in insulin secretory granules and likely cosecreted with insulin. Ref.5 |
| Subcellular location | Secreted. Note: Localized in discrete vesicular and perinuclear structure. |
| Tissue specificity | Highly expressed in the pancreas. Also found in the colon, kidney, prostate, small intestine and testis. Ref.5 |
| Post-translational modification | 2 N-termini have been observed in the mature protein: the first at Glu-30, resulting from signal peptide cleavage, the second at Ser-46. |
| Sequence similarities | Belongs to the FAM3 family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Apoptosis |
| Cellular component | Secreted |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Signal |
| Molecular function | Cytokine |
| PTM | Disulfide bond Glycoprotein |
| Technical term | Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Biological process | apoptotic process Inferred from electronic annotation. Source: UniProtKB-KW insulin secretionInferred from direct assay Ref.2. Source: UniProtKB |
| Cellular component | extracellular space Inferred from electronic annotation. Source: UniProtKB-KW |
| Molecular function | cytokine activity Non-traceable author statement Ref.2. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform B (identifier: P58499-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform A (identifier: P58499-2) The sequence of this isoform differs from the canonical sequence as follows: 7-7: G → GSRWACWLTRCLISCFDINVQGRLLVKLRPKPTANTTCPG | ||||||
| Isoform C (identifier: P58499-3) The sequence of this isoform differs from the canonical sequence as follows: 7-54: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 29 | 29 | |||||||||
| Chain | 30 – 235 | 206 | Protein FAM3B | PRO_0000008750 | |||||||
Amino acid modifications | |||||||||||
| Glycosylation | 120 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 208 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 63 ↔ 69 | Potential | |||||||||
| Disulfide bond | 91 ↔ 229 | Ref.5 | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 7 – 54 | 48 | Missing in isoform C. | VSP_001505 | |||||||
| Alternative sequence | 7 | 1 | G → GSRWACWLTRCLISCFDINV QGRLLVKLRPKPTANTTCPG in isoform A. | VSP_001504 | |||||||
| Natural variant | 14 | 1 | V → M. Corresponds to variant rs2838012 [ dbSNP | Ensembl ]. | VAR_021953 | |||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "From PREDs and open reading frames to cDNA isolation: revisiting the human chromosome 21 transcription map." Reymond A., Friedli M., Neergaard Henrichsen C., Chapot F., Deutsch S., Ucla C., Rossier C., Lyle R., Guipponi M., Antonarakis S.E. Genomics 78:46-54(2001) [PubMed: 11707072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A; B AND C). |
| [2] | "Cloning, expression, and initial characterization of a novel cytokine-like gene family." Zhu Y., Xu G., Patel A., McLaughlin M.M., Silverman C., Knecht K.A., Sweitzer S., Li X., McDonnell P., Mirabile R., Zimmerman D., Boyce R., Tierney L.A., Hu E., Livi G.P., Wolf B.A., Abdel-Meguid S.S., Rose G.D. Young P.R.Genomics 80:144-150(2002) [PubMed: 12160727] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM B), PARTIAL PROTEIN SEQUENCE, CHARACTERIZATION. |
| [3] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed: 12975309] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM B). |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM B). Tissue: Placenta. |
| [5] | "Structure-function studies of PANDER, an islet specific cytokine inducing cell death of insulin-secreting beta cells." Yang J., Gao Z., Robert C.E., Burkhardt B.R., Gaweska H., Wagner A., Wu J., Greene S.R., Young R.A., Wolf B.A. Biochemistry 44:11342-11352(2005) [PubMed: 16114871] [Abstract] Cited for: FUNCTION, TISSUE SPECIFICITY, DISULFIDE BONDS. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ409094 mRNA. Translation: CAC83974.1. AF375989 mRNA. Translation: AAL34495.1. AY040086 mRNA. Translation: AAK74134.1. AF494379 mRNA. Translation: AAM94280.1. AY358459 mRNA. Translation: AAQ88824.1. BC057829 mRNA. Translation: AAH57829.1. |
| IPI | IPI00067738. IPI00219788. IPI00219789. |
| RefSeq | NP_478066.3. NM_058186.3. NP_996847.1. NM_206964.1. |
| UniGene | Hs.473877. Hs.670704. |
3D structure databases | |
| ProteinModelPortal | P58499. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | P58499. |
Polymorphism databases | |
| DMDM | 23821535. |
Proteomic databases | |
| PRIDE | P58499. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000357985; ENSP00000350673; ENSG00000183844. |
| GeneID | 54097. |
| KEGG | hsa:54097. |
| UCSC | uc002yzb.1. human. uc002yzc.1. human. |
Organism-specific databases | |
| CTD | 54097. |
| GeneCards | GC21P042676. |
| H-InvDB | HIX0203130. |
| HGNC | HGNC:1253. FAM3B. |
| HPA | HPA015885. |
| MIM | 608617. gene. |
| neXtProt | NX_P58499. |
| PharmGKB | PA27979. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG09340. |
| GeneTree | ENSGT00530000063020. |
| HOVERGEN | HBG099991. |
| InParanoid | P58499. |
| OrthoDB | EOG48WC2S. |
Gene expression databases | |
| ArrayExpress | P58499. |
| Bgee | P58499. |
| CleanEx | HS_FAM3B. |
| Genevestigator | P58499. |
| GermOnline | ENSG00000183844. Homo sapiens. |
Family and domain databases | |
| ProtoNet | Search... |
Other | |
| NextBio | 56442. |
| SOURCE | Search... |
Entry information
| Entry name | FAM3B_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P58499 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 21 Human chromosome 21: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with