P58418 (CLRN1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 97.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Clarin-1 Alternative name(s): Usher syndrome type-3 protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 232 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May have a role in the excitatory ribbon synapse junctions between hair cells and cochlear ganglion cells and presumably also in analogous synapses within the retina. Ref.3 |
| Subcellular location | Membrane; Multi-pass membrane protein Potential. |
| Tissue specificity | Widely expressed. Found in the retina. |
| Involvement in disease | Usher syndrome 3A (USH3A) [MIM:276902]: USH is a genetically heterogeneous condition characterized by the association of retinitis pigmentosa with sensorineural deafness. Age at onset and differences in auditory and vestibular function distinguish Usher syndrome type 1 (USH1), Usher syndrome type 2 (USH2) and Usher syndrome type 3 (USH3). USH3 is characterized by postlingual, progressive hearing loss, variable vestibular dysfunction, and onset of retinitis pigmentosa symptoms, including nyctalopia, constriction of the visual fields, and loss of central visual acuity, usually by the second decade of life. Retinitis pigmentosa 61 (RP61) [MIM:614180]: A retinal dystrophy belonging to the group of pigmentary retinopathies. Retinitis pigmentosa is characterized by retinal pigment deposits visible on fundus examination and primary loss of rod photoreceptor cells followed by secondary loss of cone photoreceptors. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well. |
| Sequence similarities | Belongs to the clarin family. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform 1 (identifier: P58418-3) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P58418-1) Also known as: A; The sequence of this isoform differs from the canonical sequence as follows: 1-85: MPSQQKKIIF...LGARPFRFSF → MQALQQQPV 191-232: VIFFCFFVHFLNGLLIRLAGFQFPFAKSKDAETTNVAADLMY → LTKGHS | ||||||
| Isoform 3 (identifier: P58418-4) Also known as: 0-2-2b-3; The sequence of this isoform differs from the canonical sequence as follows: 144-144: S → SVALWLPATRHQAQ |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 232 | 232 | Clarin-1 | PRO_0000065729 | |||||
Regions | |||||||||
| Transmembrane | 8 – 28 | 21 | Helical; Potential | ||||||
| Transmembrane | 101 – 121 | 21 | Helical; Potential | ||||||
| Transmembrane | 135 – 155 | 21 | Helical; Potential | ||||||
| Transmembrane | 186 – 206 | 21 | Helical; Potential | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 48 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 85 | 85 | MPSQQ…FRFSF → MQALQQQPV in isoform 2. | VSP_022868 | |||||
| Alternative sequence | 144 | 1 | S → SVALWLPATRHQAQ in isoform 3. | VSP_043303 | |||||
| Alternative sequence | 191 – 232 | 42 | VIFFC…ADLMY → LTKGHS in isoform 2. | VSP_022869 | |||||
| Natural variant | 7 | 1 | K → I. Corresponds to variant rs3796241 [ dbSNP | Ensembl ]. | VAR_053825 | |||||
| Natural variant | 31 | 1 | P → L in RP61; the mutant protein is retained in the endoplasmic reticulum. Ref.10 | VAR_066673 | |||||
| Natural variant | 40 | 1 | C → G in USH3A. Ref.8 | VAR_054555 | |||||
| Natural variant | 48 | 1 | N → K in USH3A. Ref.2 Ref.3 | VAR_030345 | |||||
| Natural variant | 105 | 1 | S → P in USH3A. Ref.9 | VAR_054556 | |||||
| Natural variant | 120 | 1 | M → K in USH3A. Ref.1 | VAR_012241 | |||||
| Natural variant | 150 | 1 | L → P in USH3A. Ref.2 | VAR_030346 | |||||
| Natural variant | 153 – 154 | 2 | IL → M in USH3A. | VAR_012242 | |||||
| Natural variant | 154 | 1 | L → W in RP61; the mutant protein is retained in the endoplasmic reticulum. Ref.10 | VAR_066674 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Mutations in a novel gene with transmembrane domains underlie Usher syndrome type 3." Joensuu T., Haemaelaeinen R., Yuan B., Johnson C., Tegelberg S., Gasparini P., Zelante L., Pirvola U., Pakarinen L., Lehesjoki A.-E., de la Chapelle A., Sankila E.-M. Am. J. Hum. Genet. 69:673-684(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), VARIANTS USH3A LYS-120 AND 153-ILE-LEU-154 DELINS MET. |
| [2] | "Usher syndrome type III: revised genomic structure of the USH3 gene and identification of novel mutations." Fields R.R., Zhou G., Huang D., Davis J.R., Moeller C., Jacobson S.G., Kimberling W.J., Sumegi J. Am. J. Hum. Genet. 71:607-617(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS USH3A LYS-48 AND PRO-150. |
| [3] | "USH3A transcripts encode clarin-1, a four-transmembrane-domain protein with a possible role in sensory synapses." Adato A., Vreugde S., Joensuu T., Avidan N., Hamalainen R., Belenkiy O., Olender T., Bonne-Tamir B., Ben-Asher E., Espinos C., Millan J.M., Lehesjoki A.-E., Flannery J.G., Avraham K.B., Pietrokovski S., Sankila E.-M., Beckmann J.S., Lancet D. Eur. J. Hum. Genet. 10:339-350(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT USH3A LYS-48, FUNCTION. Tissue: Retina. |
| [4] | "Alternative splice variants of the USH3A gene Clarin 1 (CLRN1)." Vastinsalo H., Jalkanen R., Dinculescu A., Isosomppi J., Geller S., Flannery J.G., Hauswirth W.W., Sankila E.M. Eur. J. Hum. Genet. 19:30-35(2011) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), ALTERNATIVE SPLICING. Tissue: Retina. |
| [5] | "The DNA sequence, annotation and analysis of human chromosome 3." Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J. Gibbs R.A.Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [8] | "Mutation screening of USH3 gene (clarin-1) in Spanish patients with Usher syndrome: low prevalence and phenotypic variability." Aller E., Jaijo T., Oltra S., Alio J., Galan F., Najera C., Beneyto M., Millan J.M. Clin. Genet. 66:525-529(2004) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT USH3A GLY-40. |
| [9] | "Spectrum of USH2A mutations in Scandinavian patients with Usher syndrome type II." Dreyer B., Brox V., Tranebjaerg L., Rosenberg T., Sadeghi A.M., Moeller C., Nilssen O. Hum. Mutat. 29:451-451(2008) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT USH3A PRO-105. |
| [10] | "CLRN1 mutations cause nonsyndromic retinitis pigmentosa." Khan M.I., Kersten F.F., Azam M., Collin R.W., Hussain A., Shah S.T., Keunen J.E., Kremer H., Cremers F.P., Qamar R., den Hollander A.I. Ophthalmology 118:1444-1448(2011) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS RP61 LEU-31 AND TRP-154, CHARACTERIZATION OF VARIANTS RP61 LEU-31 AND TRP-154. |
Web resources
| Mutations of the USH3A gene Retina International's Scientific Newsletter |
| GeneReviews |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF388366 mRNA. Translation: AAL09581.1. AF482697 mRNA. Translation: AAN07148.1. AF495717 mRNA. Translation: AAM88774.1. HM626132 mRNA. Translation: ADM63096.1. AC020636 Genomic DNA. No translation available. CH471052 Genomic DNA. Translation: EAW78814.1. CH471052 Genomic DNA. Translation: EAW78815.1. BC074970 mRNA. Translation: AAH74970.1. BC074971 mRNA. Translation: AAH74971.1. |
| IPI | IPI00048232. IPI00166977. IPI00981935. |
| RefSeq | NP_001182723.1. NM_001195794.1. NP_443721.1. NM_052995.2. NP_777367.1. NM_174878.2. |
| UniGene | Hs.380222. |
3D structure databases | |
| ProteinModelPortal | P58418. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000322280. |
PTM databases | |
| PhosphoSite | P58418. |
Polymorphism databases | |
| DMDM | 125987806. |
Proteomic databases | |
| PaxDb | P58418. |
| PRIDE | P58418. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000295911; ENSP00000295911; ENSG00000163646. ENST00000327047; ENSP00000322280; ENSG00000163646. ENST00000328863; ENSP00000329158; ENSG00000163646. |
| GeneID | 7401. |
| KEGG | hsa:7401. |
| UCSC | uc003eyj.3. human. uc003eyk.1. human. |
Organism-specific databases | |
| CTD | 7401. |
| GeneCards | GC03M150643. |
| HGNC | HGNC:12605. CLRN1. |
| MIM | 276902. phenotype. 606397. gene. 614180. phenotype. |
| neXtProt | NX_P58418. |
| Orphanet | 791. Retinitis pigmentosa. 231183. Usher syndrome type 3. |
| PharmGKB | PA37231. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG44698. |
| HOGENOM | HOG000060265. |
| HOVERGEN | HBG061269. |
| InParanoid | P58418. |
| OMA | QCGLGAR. |
| PhylomeDB | P58418. |
Gene expression databases | |
| ArrayExpress | P58418. |
| Bgee | P58418. |
| CleanEx | HS_CLRN1. |
| Genevestigator | P58418. |
| GermOnline | ENSG00000163646. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR026748. Clarin. [Graphical view] |
| PANTHER | PTHR31548. PTHR31548. 1 hit. |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 7401. |
| NextBio | 28970. |
| SOURCE | Search... |
Entry information
| Entry name | CLRN1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P58418 Secondary accession number(s): D3DNJ3, E1ACU9, Q8N6A9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
