P58335 (ANTR2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 18, 2012.
Version 114.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Anthrax toxin receptor 2 Alternative name(s): Capillary morphogenesis gene 2 protein Short name=CMG-2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 489 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Necessary for cellular interactions with laminin and the extracellular matrix. Ref.1 Ref.15 |
| Subunit structure | Binds laminin, and possibly also collagen type IV. Binds to the protective antigen (PA) of Bacillus anthracis in a divalent cation-dependent manner, with the following preference: calcium > manganese > magnesium > zinc. Binding of PA leads to heptamerization of the receptor-PA complex. |
| Subcellular location | Isoform 1: Cell membrane; Single-pass type I membrane protein. Note: Expressed at the cell surface. Isoform 2: Endoplasmic reticulum membrane; Single-pass type I membrane protein. Note: Expressed predominantly within the endoplasmic reticulum and not at the plasma membrane. |
| Tissue specificity | Expressed in prostate, thymus, ovary, testis, pancreas, colon, heart, kidney, lung, liver, peripheral blood leukocytes, placenta, skeletal muscle, small intestine and spleen. Ref.14 |
| Domain | Binding to PA seems to be effected through the VWA domain. |
| Involvement in disease | Defects in ANTXR2 are the cause of infantile systemic hyalinosis (ISH) [MIM:236490]. This autosomal recessive syndrome is similar to JHF, but has an earlier onset and a more severe course. Symptoms appear at birth or within the first months of life, with painful, swollen joint contractures, osteopenia, osteoporosis and livid red hyperpigmentation over bony prominences. Patients develop multiple subcutaneous skin tumors and gingival hypertrophy. Hyaline deposits in multiple organs, recurrent infections and intractable diarrhea often lead to death within the first 2 years of life. Surviving children may suffer from severely reduced mobility due to joint contractures. Ref.14 Ref.15 Defects in ANTXR2 are the cause of juvenile hyaline fibromatosis (JHF) [MIM:228600]. JHF is an autosomal recessive syndrome that is similar to ISH but takes a milder course. It is characterized by hyaline deposition in the dermis, multiple subcutaneous skin tumors and gingival hypertrophy, followed by progressive joint contractions, osteopenia and osteoporosis that may lead to a severe limitation of mobility. Ref.14 Ref.15 |
| Miscellaneous | Upon binding of the protective antigen (PA) of Bacillus anthracis the complex moves to glycosphingolipid-rich lipid rafts, where it is internalized via a clathrin-dependent pathway. |
| Sequence similarities | Belongs to the ATR family. Contains 1 VWFA domain. |
| Sequence caution | The sequence AAY40907.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence BAB70976.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence BAD93150.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| pagA | P13423 | 7 | EBI-456840,EBI-456868 | From a different organism. |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P58335-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P58335-2) The sequence of this isoform differs from the canonical sequence as follows: 213-315: Missing. | ||||||
| Isoform 3 (identifier: P58335-3) The sequence of this isoform differs from the canonical sequence as follows: 290-322: TLDVSVSFNGGKSVISGSLIVTATECSNGIAAI → WGLTVTQAGVKWHDLTHCTFGLSGSGDPPTSAS 323-489: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 4 (identifier: P58335-4) The sequence of this isoform differs from the canonical sequence as follows: 477-489: VCIWECIEKELTA → GRCINFSRVPSQ |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 33 | 33 | Potential | ||||||||||||||||||||||||||||||
| Chain | 34 – 489 | 456 | Anthrax toxin receptor 2 | PRO_0000002694 | |||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||
| Topological domain | 34 – 318 | 285 | Extracellular Potential | ||||||||||||||||||||||||||||||
| Transmembrane | 319 – 341 | 23 | Helical; Potential | ||||||||||||||||||||||||||||||
| Topological domain | 342 – 489 | 148 | Cytoplasmic Potential | ||||||||||||||||||||||||||||||
| Domain | 44 – 213 | 170 | VWFA | ||||||||||||||||||||||||||||||
| Compositional bias | 352 – 360 | 9 | Poly-Pro | ||||||||||||||||||||||||||||||
| Compositional bias | 362 – 366 | 5 | Poly-Glu | ||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||
| Metal binding | 52 | 1 | Divalent metal cation | ||||||||||||||||||||||||||||||
| Metal binding | 54 | 1 | Divalent metal cation | ||||||||||||||||||||||||||||||
| Metal binding | 118 | 1 | Divalent metal cation | ||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||
| Modified residue | 147 | 1 | Phosphothreonine Ref.10 | ||||||||||||||||||||||||||||||
| Glycosylation | 250 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||
| Glycosylation | 260 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||
| Disulfide bond | 39 ↔ 218 | ||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||
| Alternative sequence | 213 – 315 | 103 | Missing in isoform 2. | VSP_008343 | |||||||||||||||||||||||||||||
| Alternative sequence | 290 – 322 | 33 | TLDVS…GIAAI → WGLTVTQAGVKWHDLTHCTF GLSGSGDPPTSAS in isoform 3. | VSP_008344 | |||||||||||||||||||||||||||||
| Alternative sequence | 323 – 489 | 167 | Missing in isoform 3. | VSP_008345 | |||||||||||||||||||||||||||||
| Alternative sequence | 477 – 489 | 13 | VCIWE…KELTA → GRCINFSRVPSQ in isoform 4. | VSP_008346 | |||||||||||||||||||||||||||||
| Natural variant | 45 | 1 | L → P in ISH. Ref.14 | VAR_022687 | |||||||||||||||||||||||||||||
| Natural variant | 105 | 1 | G → D in JHF. Ref.15 | VAR_022688 | |||||||||||||||||||||||||||||
| Natural variant | 189 | 1 | I → T in ISH. Ref.14 Ref.15 | VAR_022689 | |||||||||||||||||||||||||||||
| Natural variant | 218 | 1 | C → R in ISH. Ref.14 | VAR_022690 | |||||||||||||||||||||||||||||
| Natural variant | 293 | 1 | V → VQ in JHF. Ref.14 | VAR_022691 | |||||||||||||||||||||||||||||
| Natural variant | 329 | 1 | L → R in JHF. Ref.15 | VAR_022692 | |||||||||||||||||||||||||||||
| Natural variant | 357 | 1 | A → P. Ref.1 Ref.2 Ref.4 Ref.7 Ref.14 Corresponds to variant rs12647691 [ dbSNP | Ensembl ]. | VAR_022693 | |||||||||||||||||||||||||||||
| Natural variant | 381 | 1 | Y → C in JHF. Ref.14 | VAR_022694 | |||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||
| Beta strand | 43 – 50 | 8 | |||||||||||||||||||||||||||||||
| Helix | 53 – 58 | 6 | |||||||||||||||||||||||||||||||
| Helix | 59 – 72 | 14 | |||||||||||||||||||||||||||||||
| Beta strand | 79 – 96 | 18 | |||||||||||||||||||||||||||||||
| Helix | 99 – 110 | 12 | |||||||||||||||||||||||||||||||
| Helix | 120 – 134 | 15 | |||||||||||||||||||||||||||||||
| Helix | 136 – 138 | 3 | |||||||||||||||||||||||||||||||
| Beta strand | 139 – 147 | 9 | |||||||||||||||||||||||||||||||
| Helix | 155 – 168 | 14 | |||||||||||||||||||||||||||||||
| Beta strand | 172 – 177 | 6 | |||||||||||||||||||||||||||||||
| Helix | 183 – 189 | 7 | |||||||||||||||||||||||||||||||
| Beta strand | 190 – 192 | 3 | |||||||||||||||||||||||||||||||
| Helix | 193 – 195 | 3 | |||||||||||||||||||||||||||||||
| Beta strand | 196 – 204 | 9 | |||||||||||||||||||||||||||||||
| Helix | 205 – 214 | 10 | |||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Differential gene expression during capillary morphogenesis in 3D collagen matrices: regulated expression of genes involved in basement membrane matrix assembly, cell cycle progression, cellular differentiation and G-protein signaling." Bell S.E., Mavila A., Salazar R., Bayless K.J., Kanagala S., Maxwell S.A., Davis G.E. J. Cell Sci. 114:2755-2773(2001) [PubMed: 11683410] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, VARIANT PRO-357. |
| [2] | "Human capillary morphogenesis protein 2 functions as an anthrax toxin receptor." Scobie H.M., Rainey G.J.A., Bradley K.A., Young J.A.T. Proc. Natl. Acad. Sci. U.S.A. 100:5170-5174(2003) [PubMed: 12700348] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INTERACTION WITH ANTHRAX TOXIN, VARIANT PRO-357. Tissue: Placenta. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 63-489 (ISOFORM 3). Tissue: Synovial cell. |
| [4] | Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F. Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), VARIANT PRO-357. Tissue: Aortic endothelium. |
| [5] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed: 15815621] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 137-489 (ISOFORM 4). Tissue: Lymph node. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 248-489 (ISOFORM 4), VARIANT PRO-357. Tissue: Brain. |
| [8] | "Anthrax toxin triggers endocytosis of its receptor via a lipid raft-mediated clathrin-dependent process." Abrami L., Liu S., Cosson P., Leppla S.H., van der Goot F.G. J. Cell Biol. 160:321-328(2003) [PubMed: 12551953] [Abstract] Cited for: INTERACTION WITH ANTHRAX TOXIN, CLATHRIN-DEPENDENT INTERNALIZATION. |
| [9] | "Membrane insertion of anthrax protective antigen and cytoplasmic delivery of lethal factor occur at different stages of the endocytic pathway." Abrami L., Lindsay M., Parton R.G., Leppla S.H., van der Goot F.G. J. Cell Biol. 166:645-651(2004) [PubMed: 15337774] [Abstract] Cited for: INTERNALIZATION. |
| [10] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed: 19690332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-147, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [11] | "Crystal structure of a complex between anthrax toxin and its host cell receptor." Santelli E., Bankston L.A., Leppla S.H., Liddington R.C. Nature 430:905-908(2004) [PubMed: 15243628] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.5 ANGSTROMS) OF 40-212 OF COMPLEX WITH THE PROTECTIVE ANTIGEN OF BACILLUS ANTHRACIS. |
| [12] | "Crystal structure of the von Willebrand factor A domain of human capillary morphogenesis protein 2: an anthrax toxin receptor." Lacy D.B., Wigelsworth D.J., Scobie H.M., Young J.A.T., Collier R.J. Proc. Natl. Acad. Sci. U.S.A. 101:6367-6372(2004) [PubMed: 15079089] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.5 ANGSTROMS) OF 38-217. |
| [13] | "Structure of heptameric protective antigen bound to an anthrax toxin receptor: a role for receptor in pH-dependent pore formation." Lacy D.B., Wigelsworth D.J., Melnyk R.A., Harrison S.C., Collier R.J. Proc. Natl. Acad. Sci. U.S.A. 101:13147-13151(2004) [PubMed: 15326297] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (3.6 ANGSTROMS) OF 38-218 OF COMPLEX WITH THE PROTECTIVE ANTIGEN OF BACILLUS ANTHRACIS. |
| [14] | "Mutations in the gene encoding capillary morphogenesis protein 2 cause juvenile hyaline fibromatosis and infantile systemic hyalinosis." Hanks S., Adams S., Douglas J., Arbour L., Atherton D.J., Balci S., Bode H., Campbell M.E., Feingold M., Keser G., Kleijer W., Mancini G., McGrath J.A., Muntoni F., Nanda A., Teare M.D., Warman M., Pope F.M. Rahman N.Am. J. Hum. Genet. 73:791-800(2003) [PubMed: 14508707] [Abstract] Cited for: VARIANTS ISH PRO-45; THR-189 AND ARG-218, VARIANTS JHF GLN-293 INS AND CYS-381, VARIANT PRO-357, TISSUE SPECIFICITY. |
| [15] | "Mutations in capillary morphogenesis gene-2 result in the allelic disorders juvenile hyaline fibromatosis and infantile systemic hyalinosis." Dowling O., Difeo A., Ramirez M.C., Tukel T., Narla G., Bonafe L., Kayserili H., Yuksel-Apak M., Paller A.S., Norton K., Teebi A.S., Grum-Tokars V., Martin G.S., Davis G.E., Glucksman M.J., Martignetti J.A. Am. J. Hum. Genet. 73:957-966(2003) [PubMed: 12973667] [Abstract] Cited for: VARIANT ISH THR-189, VARIANTS JHF ASP-105 AND ARG-329, FUNCTION. |
| [16] | "Capillary morphogenesis gene-2 mutation in infantile systemic hyalinosis: ultrastructural study and mutation analysis in a Taiwanese infant." Lee J.Y.-Y., Tsai Y.-M., Chao S.-C., Tu Y.-F. Clin. Exp. Dermatol. 30:176-179(2005) [PubMed: 15725249] [Abstract] Cited for: INVOLVEMENT IN INFANTILE SYSTEMIC HYALINOSIS. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AY040326 mRNA. Translation: AAK77222.1. AY233452 mRNA. Translation: AAP04016.1. AK055636 mRNA. Translation: BAB70976.1. Different initiation. AK091721 mRNA. Translation: BAC03731.1. AB209913 mRNA. Translation: BAD93150.1. Different initiation. AC097711 Genomic DNA. Translation: AAY40907.1. Sequence problems. AC109518 Genomic DNA. No translation available. AC114773 Genomic DNA. No translation available. AL832851 mRNA. Translation: CAI46157.2. BC034001 mRNA. Translation: AAH34001.2. | ||||||||||||||||||||||||||||||
| IPI | IPI00036552. IPI00375552. IPI00375555. IPI00375556. | ||||||||||||||||||||||||||||||
| RefSeq | NP_001139266.1. NM_001145794.1. NP_477520.2. NM_058172.5. | ||||||||||||||||||||||||||||||
| UniGene | Hs.162963. | ||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||
| ProteinModelPortal | P58335. | ||||||||||||||||||||||||||||||
| SMR | P58335. Positions 37-255. | ||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||
| DIP | DIP-32476N. | ||||||||||||||||||||||||||||||
| IntAct | P58335. 2 interactions. | ||||||||||||||||||||||||||||||
| MINT | MINT-1184613. | ||||||||||||||||||||||||||||||
| STRING | P58335. | ||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||
| DMDM | 306526289. | ||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||
| PRIDE | P58335. | ||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||
| Ensembl | ENST00000295465; ENSP00000295465; ENSG00000163297. ENST00000307333; ENSP00000306185; ENSG00000163297. ENST00000346652; ENSP00000314883; ENSG00000163297. ENST00000399392; ENSP00000382324; ENSG00000163297. ENST00000403729; ENSP00000385575; ENSG00000163297. ENST00000404191; ENSP00000384028; ENSG00000163297. ENST00000449651; ENSP00000413700; ENSG00000163297. | ||||||||||||||||||||||||||||||
| GeneID | 118429. | ||||||||||||||||||||||||||||||
| KEGG | hsa:118429. | ||||||||||||||||||||||||||||||
| UCSC | uc003hly.4. human. uc003hlz.4. human. uc010ijn.3. human. | ||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||
| CTD | 118429. | ||||||||||||||||||||||||||||||
| GeneCards | GC04M080822. | ||||||||||||||||||||||||||||||
| H-InvDB | HIX0004329. | ||||||||||||||||||||||||||||||
| HGNC | HGNC:21732. ANTXR2. | ||||||||||||||||||||||||||||||
| MIM | 228600. phenotype. 236490. phenotype. 608041. gene. | ||||||||||||||||||||||||||||||
| neXtProt | NX_P58335. | ||||||||||||||||||||||||||||||
| Orphanet | 2176. Infantile systemic hyalinosis. 2028. Juvenile hyaline fibromatosis. | ||||||||||||||||||||||||||||||
| PharmGKB | PA128394752. | ||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||
| eggNOG | NOG41216. | ||||||||||||||||||||||||||||||
| GeneTree | ENSGT00430000031214. | ||||||||||||||||||||||||||||||
| HOVERGEN | HBG050514. | ||||||||||||||||||||||||||||||
| InParanoid | P58335. | ||||||||||||||||||||||||||||||
| OMA | PTHQPPQ. | ||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | anthraxpathway. Cellular roles of Anthrax toxin. | ||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||
| ArrayExpress | P58335. | ||||||||||||||||||||||||||||||
| Bgee | P58335. | ||||||||||||||||||||||||||||||
| CleanEx | HS_ANTXR2. | ||||||||||||||||||||||||||||||
| Genevestigator | P58335. | ||||||||||||||||||||||||||||||
| GermOnline | ENSG00000163297. Homo sapiens. | ||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||
| InterPro | IPR017360. Anthrax_toxin_rcpt. IPR008399. Anthrax_toxin_rcpt_C. IPR008400. Anthrax_toxin_rcpt_extracel. IPR002035. VWF_A. [Graphical view] | ||||||||||||||||||||||||||||||
| Pfam | PF05586. Ant_C. 1 hit. PF05587. Anth_Ig. 1 hit. PF00092. VWA. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||
| PIRSF | PIRSF038023. Anthrax_toxin_receptor_2. 1 hit. | ||||||||||||||||||||||||||||||
| ProDom | PD377005. Anthrax_toxin_rcpt_C. 1 hit. [Graphical view] [Entries sharing at least one domain] | ||||||||||||||||||||||||||||||
| SMART | SM00327. VWA. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||
| PROSITE | PS50234. VWFA. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||
| EvolutionaryTrace | P58335. | ||||||||||||||||||||||||||||||
| NextBio | 80274. | ||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||
Entry information
| Entry name | ANTR2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P58335 Secondary accession number(s): Q4W5H6 Q96NC7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 4 Human chromosome 4: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with