Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

E3 ubiquitin-protein ligase RNF216

Gene

Rnf216

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Acts as an E3 ubiquitin ligase, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes, and then transfers it to substrates promoting their degradation by the proteasome. Promotes degradation of TRAF3, TLR4 and TLR9. Contributes to the regulation of antiviral responses. Down-regulates activation of NF-kappa-B, IRF3 activation and IFNB production. Promotes TNF and RIP mediated apoptosis (By similarity).By similarity

Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri503 – 55452RING-type 1Add
BLAST
Zinc fingeri571 – 63666IBR-typeAdd
BLAST
Zinc fingeri663 – 70240RING-type 2Add
BLAST

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Ligase

Keywords - Biological processi

Apoptosis, Ubl conjugation pathway

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

UniPathwayiUPA00143.

Names & Taxonomyi

Protein namesi
Recommended name:
E3 ubiquitin-protein ligase RNF216 (EC:6.3.2.-)
Alternative name(s):
RING finger protein 216
Triad domain-containing protein 3
UbcM4-interacting protein 83
Ubiquitin-conjugating enzyme 7-interacting protein 1
Gene namesi
Name:Rnf216
Synonyms:Triad3, Ubce7ip1, Uip83, Zin
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 5

Organism-specific databases

MGIiMGI:1344349. Rnf216.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 853853E3 ubiquitin-protein ligase RNF216PRO_0000056294Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Cross-linki339 – 339Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei407 – 4071PhosphoserineCombined sources
Cross-linki436 – 436Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki646 – 646Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity

Post-translational modificationi

Auto-ubiquitinated.By similarity

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiP58283.
MaxQBiP58283.
PRIDEiP58283.

PTM databases

iPTMnetiP58283.
PhosphoSiteiP58283.

Expressioni

Gene expression databases

BgeeiP58283.
CleanExiMM_RNF216.
ExpressionAtlasiP58283. baseline and differential.
GenevisibleiP58283. MM.

Interactioni

Subunit structurei

Interacts with UBE2L3 and to some extent with UBE2L6. Interacts with RIPK1, TRAF3, TLR3, TLR4, TLR5 and TLR9 (By similarity).By similarity

Protein-protein interaction databases

BioGridi223823. 1 interaction.

Structurei

3D structure databases

ProteinModelPortaliP58283.
SMRiP58283. Positions 503-695.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili463 – 47917Sequence analysisAdd
BLAST
Coiled coili725 – 75127Sequence analysisAdd
BLAST

Sequence similaritiesi

Contains 1 IBR-type zinc finger.Curated
Contains 2 RING-type zinc fingers.Curated

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri503 – 55452RING-type 1Add
BLAST
Zinc fingeri571 – 63666IBR-typeAdd
BLAST
Zinc fingeri663 – 70240RING-type 2Add
BLAST

Keywords - Domaini

Coiled coil, Repeat, Zinc-finger

Phylogenomic databases

GeneTreeiENSGT00510000048032.
HOVERGENiHBG102854.
InParanoidiP58283.
KOiK11976.
OMAiPAPQQHD.
OrthoDBiEOG7B8S3G.
PhylomeDBiP58283.
TreeFamiTF330852.

Family and domain databases

InterProiIPR002867. IBR_dom.
[Graphical view]
SMARTiSM00647. IBR. 2 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P58283-1) [UniParc]FASTAAdd to basket

Also known as: TRIAD3A, a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAEGNNKEEV IHLNNFPCHR GKEWMAVREG PITISDSSDE EGIPMLVTPA
60 70 80 90 100
TEQQEDDLDD DVILTEDDSE DEYGGFLDLE SGKKEGEAKP GPSSKQTADD
110 120 130 140 150
IVNPRLEQKV IILGENGLLF PESEPLEVQN QSSEDSETEL LSNPGEPAAS
160 170 180 190 200
VDDQLIGEEY WLDHPYFQAP NPQPQERTNQ VVPQERHSES EMGPMFFRHD
210 220 230 240 250
FPEPAFPRPE PQQEGIPGPA SPQPAHPLGE LEDQQLAIDE DPGPAFPLSG
260 270 280 290 300
PQEANLANMW EQEAAEVDQD LIPLLVKETE ARFPDVASGY VEEIIHLKNY
310 320 330 340 350
YDLNVLCNFL LENPDYPKRE DRLIIHPSSS LLASQDDAKL PKIDFFDYSK
360 370 380 390 400
LTPLDQRCFI QAADLLMADF KMLSSQDIKW ALHELKGHYA ITRKAFSDAI
410 420 430 440 450
KKWQELSPET SGKRKKRKEM NQYSFIDFKF EQGNIKIEKR MFFLENKRRH
460 470 480 490 500
CRYYDHQALL PAVKQEQEFY EQKIKEMAEH EDFLLALQMN EEQYQKDGQL
510 520 530 540 550
IECRCCYGEF PFEELTQCAD AHLFCKECLI RYAQEAVFGS GKSELSCMEG
560 570 580 590 600
SCTCSFPTSE LEKVLPQTIL YKYYERKAEE EVAAAYADEL VRCPSCSFPA
610 620 630 640 650
LLDSDVKRFS CPNPRCRKET CRKCQGLWKE HNGLTCEELA EKDDIKYRTS
660 670 680 690 700
IEEKMTAARI RKCHKCGTGL IKSEGCNRMS CRCGAQMCYL CRVSINGYDH
710 720 730 740 750
FCQHPRSPGA PCQECSRCSL WTDPTEDDEK LIEEIQKEAE EEQKRKNGEN
760 770 780 790 800
TFKRIGPPLE KPAEKVQRVE ALPRPVPQNL HPQMPPYAFV HPPFPLPPVR
810 820 830 840 850
PVFNNFPINM GPVPAPYVPP LPNVRVNYDF GHMHVPLEHN LPMHFGPQPR

HRF
Length:853
Mass (Da):97,682
Last modified:January 4, 2005 - v3
Checksum:i3EFE484C5AA5E0B8
GO
Isoform 2 (identifier: P58283-2) [UniParc]FASTAAdd to basket

Also known as: TRIAD3B, b

The sequence of this isoform differs from the canonical sequence as follows:
     66-66: E → ETHKPQTSRPNLIKPAAQWQDLNRLGEERPRKSRADFEADIHNYFSFCNNSLFGSGAQ

Show »
Length:910
Mass (Da):104,210
Checksum:i18416DDBDA3778DE
GO
Isoform 3 (identifier: P58283-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     619-732: ETCRKCQGLW...DPTEDDEKLI → VRRTVVCVSS...CKLGKICMDI
     733-853: Missing.

Note: No experimental confirmation available.
Show »
Length:732
Mass (Da):83,612
Checksum:iD83A9288DC0C2740
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti377 – 3771D → A in BAE32540 (PubMed:16141072).Curated
Sequence conflicti577 – 5771K → R in BAE28184 (PubMed:16141072).Curated
Sequence conflicti640 – 6401A → V in BAE28184 (PubMed:16141072).Curated
Sequence conflicti646 – 6461K → E in BAE28184 (PubMed:16141072).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei66 – 661E → ETHKPQTSRPNLIKPAAQWQ DLNRLGEERPRKSRADFEAD IHNYFSFCNNSLFGSGAQ in isoform 2. 2 PublicationsVSP_007408
Alternative sequencei619 – 732114ETCRK…DEKLI → VRRTVVCVSSTLLEFGLHYA GGLCRLMHENSLPLPFMKQE KVGDGSWHSYRDEITCGNPI AKFRISRLCHFIKTGAVKMC LLLLCRIFCLLFSLSCTQIQ HIHTCKLGKICMDI in isoform 3. 1 PublicationVSP_019293Add
BLAST
Alternative sequencei733 – 853121Missing in isoform 3. 1 PublicationVSP_019294Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY572785 mRNA. Translation: AAS78930.1.
AY572786 mRNA. Translation: AAS78931.1.
AK089775 mRNA. Translation: BAC40959.1.
AK147861 mRNA. Translation: BAE28184.1.
AK149741 mRNA. Translation: BAE29055.1.
AK154368 mRNA. Translation: BAE32540.1.
BC065066 mRNA. Translation: AAH65066.1.
BC079540 mRNA. Translation: AAH79540.1.
AF361000 mRNA. Translation: AAK51470.1.
CCDSiCCDS57400.1. [P58283-2]
CCDS80455.1. [P58283-1]
RefSeqiNP_542128.2. NM_080561.4. [P58283-1]
NP_996993.1. NM_207110.1. [P58283-2]
XP_006504707.1. XM_006504644.2. [P58283-2]
XP_006504708.1. XM_006504645.2. [P58283-1]
UniGeneiMm.381440.
Mm.488397.

Genome annotation databases

EnsembliENSMUST00000053498; ENSMUSP00000052563; ENSMUSG00000045078. [P58283-1]
ENSMUST00000200607; ENSMUSP00000143705; ENSMUSG00000045078. [P58283-2]
GeneIDi108086.
KEGGimmu:108086.
UCSCiuc009ajm.2. mouse. [P58283-1]
uc009ajn.2. mouse. [P58283-2]
uc009ajo.2. mouse. [P58283-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY572785 mRNA. Translation: AAS78930.1.
AY572786 mRNA. Translation: AAS78931.1.
AK089775 mRNA. Translation: BAC40959.1.
AK147861 mRNA. Translation: BAE28184.1.
AK149741 mRNA. Translation: BAE29055.1.
AK154368 mRNA. Translation: BAE32540.1.
BC065066 mRNA. Translation: AAH65066.1.
BC079540 mRNA. Translation: AAH79540.1.
AF361000 mRNA. Translation: AAK51470.1.
CCDSiCCDS57400.1. [P58283-2]
CCDS80455.1. [P58283-1]
RefSeqiNP_542128.2. NM_080561.4. [P58283-1]
NP_996993.1. NM_207110.1. [P58283-2]
XP_006504707.1. XM_006504644.2. [P58283-2]
XP_006504708.1. XM_006504645.2. [P58283-1]
UniGeneiMm.381440.
Mm.488397.

3D structure databases

ProteinModelPortaliP58283.
SMRiP58283. Positions 503-695.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi223823. 1 interaction.

PTM databases

iPTMnetiP58283.
PhosphoSiteiP58283.

Proteomic databases

EPDiP58283.
MaxQBiP58283.
PRIDEiP58283.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000053498; ENSMUSP00000052563; ENSMUSG00000045078. [P58283-1]
ENSMUST00000200607; ENSMUSP00000143705; ENSMUSG00000045078. [P58283-2]
GeneIDi108086.
KEGGimmu:108086.
UCSCiuc009ajm.2. mouse. [P58283-1]
uc009ajn.2. mouse. [P58283-2]
uc009ajo.2. mouse. [P58283-3]

Organism-specific databases

CTDi54476.
MGIiMGI:1344349. Rnf216.

Phylogenomic databases

GeneTreeiENSGT00510000048032.
HOVERGENiHBG102854.
InParanoidiP58283.
KOiK11976.
OMAiPAPQQHD.
OrthoDBiEOG7B8S3G.
PhylomeDBiP58283.
TreeFamiTF330852.

Enzyme and pathway databases

UniPathwayiUPA00143.

Miscellaneous databases

ChiTaRSiRnf216. mouse.
NextBioi360032.
PROiP58283.
SOURCEiSearch...

Gene expression databases

BgeeiP58283.
CleanExiMM_RNF216.
ExpressionAtlasiP58283. baseline and differential.
GenevisibleiP58283. MM.

Family and domain databases

InterProiIPR002867. IBR_dom.
[Graphical view]
SMARTiSM00647. IBR. 2 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. Chuang T.H., Ulevitch R.J.
    Submitted (MAR-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
    Strain: BALB/cJ.
    Tissue: Spleen.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3).
    Strain: C57BL/6J and NOD.
    Tissue: Bone marrow macrophage, Dendritic cell, Melanocyte and Spleen.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: C57BL/6J.
    Tissue: Brain.
  4. "A family of structurally related RING finger proteins interacts specifically with the ubiquitin-conjugating enzyme UbcM4."
    Martinez-Noel G., Niedenthal R., Tamura T., Harbers K.
    FEBS Lett. 454:257-261(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 448-593, INTERACTION WITH UBE2L3.
    Strain: CD-1.
    Tissue: Embryo.
  5. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-407, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Spleen.

Entry informationi

Entry nameiRN216_MOUSE
AccessioniPrimary (citable) accession number: P58283
Secondary accession number(s): Q3U493
, Q3UE56, Q3UGM3, Q68FN0, Q6P1H8, Q6PWY5, Q8BN27, Q8C1U3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 26, 2001
Last sequence update: January 4, 2005
Last modified: May 11, 2016
This is version 126 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.