Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein DPF3

Gene

Dpf3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Muscle-specific component of the BAF complex, a multiprotein complex involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Specifically binds acetylated lysines on histone 3 and 4 (H3K14ac, H3K9ac, H4K5ac, H4K8ac, H4K12ac, H4K16ac). In the complex, it acts as a tissue-specific anchor between histone acetylations and methylations and chromatin remodeling. It thereby probably plays an essential role in heart and skeletal muscle development (By similarity). Belongs to the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a post-mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to post-mitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth.By similarity1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri198 – 221C2H2-typePROSITE-ProRule annotationAdd BLAST24
Zinc fingeri259 – 319PHD-type 1PROSITE-ProRule annotationAdd BLAST61
Zinc fingeri316 – 366PHD-type 2PROSITE-ProRule annotationAdd BLAST51

GO - Molecular functioni

GO - Biological processi

  • chromatin modification Source: UniProtKB-KW
  • nervous system development Source: UniProtKB
  • regulation of transcription, DNA-templated Source: UniProtKB-KW
  • transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Activator, Chromatin regulator, Repressor

Keywords - Biological processi

Neurogenesis, Transcription, Transcription regulation

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein DPF3
Alternative name(s):
BRG1-associated factor 45C
Short name:
BAF45C
Zinc finger protein cer-d4
Gene namesi
Name:Dpf3
Synonyms:Baf45c, Cerd4
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 12

Organism-specific databases

MGIiMGI:1917377. Dpf3.

Subcellular locationi

GO - Cellular componenti

  • nBAF complex Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001681551 – 378Zinc finger protein DPF3Add BLAST378

Proteomic databases

MaxQBiP58269.
PaxDbiP58269.
PeptideAtlasiP58269.
PRIDEiP58269.

PTM databases

PhosphoSitePlusiP58269.

Expressioni

Tissue specificityi

Expressed in the heart and somites. Expressed in cerebellum and spinal cord, but not in cerebral cortex. Expressed specifically in post-mitotic neurons (at protein level).3 Publications

Developmental stagei

First expressed in the first differentiating cardiomyocytes of the cardiac crescent at embryonic day 7.5 (E7.5) and in the first somites at E8.0. In the heart, expression is restricted to the myocardial compartment. In the developing forebrain and cerebellar primordium, strictly expressed in post-mitotic neurons.2 Publications

Gene expression databases

BgeeiENSMUSG00000021221.
CleanExiMM_DPF3.
ExpressionAtlasiP58269. baseline and differential.
GenevisibleiP58269. MM.

Interactioni

Subunit structurei

Component of the BAF complex, which includes at least actin (ACTB), ARID1A, ARID1B/BAF250, SMARCA2, SMARCA4/BRG1/BAF190A, ACTL6A/BAF53, ACTL6B/BAF53B, SMARCE1/BAF57, SMARCC1/BAF155, SMARCC2/BAF170, SMARCB1/SNF5/INI1, and one or more of SMARCD1/BAF60A, SMARCD2/BAF60B, or SMARCD3/BAF60C. In muscle cells, the BAF complex also contains DPF3. Interacts with acetylated histones H3 and H4 (By similarity). Component of neuron-specific chromatin remodeling complex (nBAF complex) composed of at least, ARID1A/BAF250A or ARID1B/BAF250B, SMARCD1/BAF60A, SMARCD3/BAF60C, SMARCA2/BRM/BAF190B, SMARCA4/BRG1/BAF190A, SMARCB1/BAF47, SMARCC1/BAF155, SMARCE1/BAF57, SMARCC2/BAF170, DPF1/BAF45B, DPF3/BAF45C, ACTL6B/BAF53B and actin.By similarity1 Publication

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000137477.

Structurei

3D structure databases

ProteinModelPortaliP58269.
SMRiP58269.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domaini

The PHD-type zinc fingers mediate the binding to acetylated histones.By similarity

Sequence similaritiesi

Belongs to the requiem/DPF family.Curated
Contains 1 C2H2-type zinc finger.PROSITE-ProRule annotation
Contains 2 PHD-type zinc fingers.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri198 – 221C2H2-typePROSITE-ProRule annotationAdd BLAST24
Zinc fingeri259 – 319PHD-type 1PROSITE-ProRule annotationAdd BLAST61
Zinc fingeri316 – 366PHD-type 2PROSITE-ProRule annotationAdd BLAST51

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1244. Eukaryota.
ENOG410YDAG. LUCA.
GeneTreeiENSGT00530000063194.
HOGENOMiHOG000217918.
HOVERGENiHBG004475.
InParanoidiP58269.
OMAiVAHAACT.
OrthoDBiEOG091G0XBM.
TreeFamiTF318971.

Family and domain databases

Gene3Di3.30.160.60. 1 hit.
3.30.40.10. 2 hits.
InterProiIPR025750. Requiem/DPF_N_dom.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
IPR011011. Znf_FYVE_PHD.
IPR001965. Znf_PHD.
IPR019787. Znf_PHD-finger.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PfamiPF00628. PHD. 1 hit.
PF14051. Requiem_N. 1 hit.
[Graphical view]
SMARTiSM00249. PHD. 2 hits.
SM00355. ZnF_C2H2. 1 hit.
[Graphical view]
SUPFAMiSSF57903. SSF57903. 2 hits.
PROSITEiPS01359. ZF_PHD_1. 1 hit.
PS50016. ZF_PHD_2. 2 hits.
PS00028. ZINC_FINGER_C2H2_1. 1 hit.
PS50157. ZINC_FINGER_C2H2_2. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P58269-1) [UniParc]FASTAAdd to basket
Also known as: DPF3b

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MATVIHNPLK ALGDQFYKEA IEHCRSYNSR LCAERSVRLP FLDSQTGVAQ
60 70 80 90 100
NNCYIWMEKR HRGPGLAPGQ LYTYPARCWR KKRRLHPPED PKLRLLEIKP
110 120 130 140 150
EVELPLKKDG FTSESTTLEA LLRGEGVEKK VDAREEESIQ EIQRVLENDE
160 170 180 190 200
NVEEGNEEED LEEDVPKRKN RTRGRARGSA GGRRRHDAAS QEDHDKPYVC
210 220 230 240 250
DICGKRYKNR PGLSYHYAHT HLASEEGDEA QDQETRSPPN HRNENHRPQK
260 270 280 290 300
GPDGTVIPNN YCDFCLGGSN MNKKSGRPEE LVSCADCGRS GHPTCLQFTL
310 320 330 340 350
NMTEAVKTYK WQCIECKSCI LCGTSENDDQ LLFCDDCDRG YHMYCLNPPV
360 370
AEPPEGSWSC HLCWELLKEK ASAFGCQA
Length:378
Mass (Da):43,070
Last modified:November 25, 2008 - v2
Checksum:i0B0B93651BF72233
GO
Isoform 2 (identifier: P58269-2) [UniParc]FASTAAdd to basket
Also known as: DPF3a

The sequence of this isoform differs from the canonical sequence as follows:
     291-378: GHPTCLQFTL...EKASAFGCQA → AHLGGEGRKE...SPTADKKGSC

Show »
Length:357
Mass (Da):40,256
Checksum:i830160EE83BB43F9
GO
Isoform 3 (identifier: P58269-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     101-101: Missing.
     291-378: GHPTCLQFTL...EKASAFGCQA → AHLGGEGRKE...SPTADKKGSC

Note: No experimental confirmation available.
Show »
Length:356
Mass (Da):40,127
Checksum:iA6F59FD06B495144
GO
Isoform 4 (identifier: P58269-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-55: MATVIHNPLKALGDQFYKEAIEHCRSYNSRLCAERSVRLPFLDSQTGVAQNNCYI → MGCLPKGHNRPGA
     291-378: GHPTCLQFTL...EKASAFGCQA → AHLGGEGRKE...SPTADKKGSC

Note: No experimental confirmation available.
Show »
Length:315
Mass (Da):35,321
Checksum:i0A732EEFA8ECED59
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0358851 – 55MATVI…NNCYI → MGCLPKGHNRPGA in isoform 4. 1 PublicationAdd BLAST55
Alternative sequenceiVSP_035886101Missing in isoform 3. Curated1
Alternative sequenceiVSP_035887291 – 378GHPTC…FGCQA → AHLGGEGRKEKEAAAAARTT EDLFGSTSESDTSTFYGFDE DDLEEPRSCRGRRSGRGSPT ADKKGSC in isoform 2, isoform 3 and isoform 4. 2 PublicationsAdd BLAST88

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF362750 mRNA. Translation: AAK54538.1.
AK039011 mRNA. Translation: BAC30204.1.
BC048572 mRNA. Translation: AAH48572.1.
CCDSiCCDS56846.1. [P58269-3]
CCDS59574.1. [P58269-1]
RefSeqiNP_001254554.1. NM_001267625.1. [P58269-1]
NP_478119.1. NM_058212.2. [P58269-3]
UniGeneiMm.151308.
Mm.403230.

Genome annotation databases

EnsembliENSMUST00000177801; ENSMUSP00000136740; ENSMUSG00000021221. [P58269-4]
ENSMUST00000177959; ENSMUSP00000137477; ENSMUSG00000021221. [P58269-3]
ENSMUST00000178756; ENSMUSP00000136280; ENSMUSG00000021221. [P58269-1]
GeneIDi70127.
KEGGimmu:70127.
UCSCiuc007odc.2. mouse. [P58269-1]
uc007odd.2. mouse. [P58269-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF362750 mRNA. Translation: AAK54538.1.
AK039011 mRNA. Translation: BAC30204.1.
BC048572 mRNA. Translation: AAH48572.1.
CCDSiCCDS56846.1. [P58269-3]
CCDS59574.1. [P58269-1]
RefSeqiNP_001254554.1. NM_001267625.1. [P58269-1]
NP_478119.1. NM_058212.2. [P58269-3]
UniGeneiMm.151308.
Mm.403230.

3D structure databases

ProteinModelPortaliP58269.
SMRiP58269.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000137477.

PTM databases

PhosphoSitePlusiP58269.

Proteomic databases

MaxQBiP58269.
PaxDbiP58269.
PeptideAtlasiP58269.
PRIDEiP58269.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000177801; ENSMUSP00000136740; ENSMUSG00000021221. [P58269-4]
ENSMUST00000177959; ENSMUSP00000137477; ENSMUSG00000021221. [P58269-3]
ENSMUST00000178756; ENSMUSP00000136280; ENSMUSG00000021221. [P58269-1]
GeneIDi70127.
KEGGimmu:70127.
UCSCiuc007odc.2. mouse. [P58269-1]
uc007odd.2. mouse. [P58269-3]

Organism-specific databases

CTDi8110.
MGIiMGI:1917377. Dpf3.

Phylogenomic databases

eggNOGiKOG1244. Eukaryota.
ENOG410YDAG. LUCA.
GeneTreeiENSGT00530000063194.
HOGENOMiHOG000217918.
HOVERGENiHBG004475.
InParanoidiP58269.
OMAiVAHAACT.
OrthoDBiEOG091G0XBM.
TreeFamiTF318971.

Miscellaneous databases

ChiTaRSiDpf3. mouse.
PROiP58269.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000021221.
CleanExiMM_DPF3.
ExpressionAtlasiP58269. baseline and differential.
GenevisibleiP58269. MM.

Family and domain databases

Gene3Di3.30.160.60. 1 hit.
3.30.40.10. 2 hits.
InterProiIPR025750. Requiem/DPF_N_dom.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
IPR011011. Znf_FYVE_PHD.
IPR001965. Znf_PHD.
IPR019787. Znf_PHD-finger.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PfamiPF00628. PHD. 1 hit.
PF14051. Requiem_N. 1 hit.
[Graphical view]
SMARTiSM00249. PHD. 2 hits.
SM00355. ZnF_C2H2. 1 hit.
[Graphical view]
SUPFAMiSSF57903. SSF57903. 2 hits.
PROSITEiPS01359. ZF_PHD_1. 1 hit.
PS50016. ZF_PHD_2. 2 hits.
PS00028. ZINC_FINGER_C2H2_1. 1 hit.
PS50157. ZINC_FINGER_C2H2_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiDPF3_MOUSE
AccessioniPrimary (citable) accession number: P58269
Secondary accession number(s): Q80W78, Q8CAD8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 26, 2001
Last sequence update: November 25, 2008
Last modified: November 30, 2016
This is version 117 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.