Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nuclear pore complex protein Nup107

Gene

NUP107

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Plays a role in the nuclear pore complex (NPC) assembly and/or maintenance. Required for the assembly of peripheral proteins into the NPC. May anchor NUP62 to the NPC.2 Publications

GO - Molecular functioni

  • nucleocytoplasmic transporter activity Source: UniProtKB
  • structural constituent of nuclear pore Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

mRNA transport, Protein transport, Translocation, Transport

Enzyme and pathway databases

ReactomeiR-HSA-1169408. ISG15 antiviral mechanism.
R-HSA-159236. Transport of Mature mRNA derived from an Intron-Containing Transcript.
R-HSA-165054. Rev-mediated nuclear export of HIV RNA.
R-HSA-168276. NS1 Mediated Effects on Host Pathways.
R-HSA-168325. Viral Messenger RNA Synthesis.
R-HSA-170822. Regulation of Glucokinase by Glucokinase Regulatory Protein.
R-HSA-180746. Nuclear import of Rev protein.
R-HSA-180910. Vpr-mediated nuclear import of PICs.
R-HSA-2467813. Separation of Sister Chromatids.
R-HSA-2500257. Resolution of Sister Chromatid Cohesion.
R-HSA-3108214. SUMOylation of DNA damage response and repair proteins.
R-HSA-3301854. Nuclear Pore Complex (NPC) Disassembly.
R-HSA-3371453. Regulation of HSF1-mediated heat shock response.
R-HSA-4570464. SUMOylation of RNA binding proteins.
R-HSA-4615885. SUMOylation of DNA replication proteins.
R-HSA-5578749. Transcriptional regulation by small RNAs.
R-HSA-5663220. RHO GTPases Activate Formins.
R-HSA-6784531. tRNA processing in the nucleus.
R-HSA-68877. Mitotic Prometaphase.

Protein family/group databases

TCDBi1.I.1.1.3. the nuclear pore complex (npc) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Nuclear pore complex protein Nup107
Alternative name(s):
107 kDa nucleoporin
Nucleoporin Nup107
Gene namesi
Name:NUP107
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

HGNCiHGNC:29914. NUP107.

Subcellular locationi

GO - Cellular componenti

  • centrosome Source: HPA
  • condensed chromosome kinetochore Source: UniProtKB-SubCell
  • cytosol Source: Reactome
  • membrane Source: UniProtKB
  • nuclear envelope Source: Reactome
  • nuclear membrane Source: UniProtKB
  • nuclear periphery Source: UniProtKB
  • nuclear pore Source: UniProtKB
  • nuclear pore outer ring Source: UniProtKB
  • nucleoplasm Source: HPA
Complete GO annotation...

Keywords - Cellular componenti

Centromere, Chromosome, Kinetochore, Membrane, Nuclear pore complex, Nucleus

Pathology & Biotechi

Involvement in diseasei

Nephrotic syndrome 11 (NPHS11)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of nephrotic syndrome, a renal disease clinically characterized by severe proteinuria, resulting in complications such as hypoalbuminemia, hyperlipidemia and edema. Kidney biopsies show non-specific histologic changes such as focal segmental glomerulosclerosis and diffuse mesangial proliferation. Some affected individuals have an inherited steroid-resistant form and progress to end-stage renal failure. NPHS11 is an autosomal recessive, steroid-resistant and progressive form with onset in the first decade of life.
See also OMIM:616730
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti157 – 1571D → Y in NPHS11; no effect on interaction with NUP133; no effect on localization to the nuclear pore. 1 Publication
VAR_076358
Natural varianti831 – 8311D → A in NPHS11; decreased interaction with NUP133; changed localization to the nuclear pore with relocalization to the cytoplasm. 1 Publication
VAR_076359

Keywords - Diseasei

Disease mutation

Organism-specific databases

MIMi616730. phenotype.
PharmGKBiPA134890486.

Polymorphism and mutation databases

BioMutaiNUP107.
DMDMi12230339.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 925925Nuclear pore complex protein Nup107PRO_0000204831Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionineCombined sources
Modified residuei4 – 41PhosphoserineCombined sources
Modified residuei10 – 101PhosphoserineCombined sources
Modified residuei11 – 111PhosphoserineCombined sources
Modified residuei37 – 371PhosphoserineCombined sources
Modified residuei46 – 461PhosphothreonineCombined sources
Modified residuei55 – 551PhosphothreonineCombined sources
Modified residuei57 – 571PhosphoserineCombined sources
Modified residuei58 – 581PhosphoserineCombined sources
Modified residuei64 – 641PhosphothreonineCombined sources
Modified residuei69 – 691PhosphoserineCombined sources
Modified residuei86 – 861PhosphoserineCombined sources

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiP57740.
MaxQBiP57740.
PaxDbiP57740.
PeptideAtlasiP57740.
PRIDEiP57740.

PTM databases

iPTMnetiP57740.
PhosphoSiteiP57740.
SwissPalmiP57740.

Expressioni

Tissue specificityi

Ubiquitously expressed in fetal and adult tissues.1 Publication

Gene expression databases

BgeeiENSG00000111581.
CleanExiHS_NUP107.
ExpressionAtlasiP57740. baseline and differential.
GenevisibleiP57740. HS.

Organism-specific databases

HPAiHPA024141.
HPA031679.

Interactioni

Subunit structurei

Part of the nuclear pore complex (NPC). Forms part of the Nup160 subcomplex in the nuclear pore which is composed of NUP160, NUP133, NUP107 and Nup96; this complex plays a role in RNA export and in tethering Nup98 and NUP153 to the nucleus. Does not interact with TPR.4 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
NUP133Q8WUM07EBI-295687,EBI-295695

Protein-protein interaction databases

BioGridi121386. 103 interactions.
IntActiP57740. 71 interactions.
MINTiMINT-3021765.
STRINGi9606.ENSP00000229179.

Structurei

Secondary structure

1
925
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi668 – 68013Combined sources
Helixi682 – 6843Combined sources
Helixi685 – 70117Combined sources
Helixi705 – 71410Combined sources
Helixi719 – 7235Combined sources
Helixi738 – 76730Combined sources
Helixi782 – 82140Combined sources
Turni824 – 8263Combined sources
Helixi840 – 86728Combined sources
Helixi871 – 8755Combined sources
Helixi877 – 8826Combined sources
Turni884 – 8863Combined sources
Helixi888 – 8914Combined sources
Helixi894 – 91219Combined sources
Turni913 – 9153Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3CQCX-ray2.53A658-925[»]
3CQGX-ray3.00A658-771[»]
A802-925[»]
3I4RX-ray3.53A658-925[»]
5A9Qelectron microscopy23.004/D/M/V1-925[»]
ProteinModelPortaliP57740.
SMRiP57740. Positions 324-580, 667-924.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP57740.

Family & Domainsi

Sequence similaritiesi

Belongs to the nucleoporin Nup84/Nup107 family.Curated

Phylogenomic databases

eggNOGiKOG1964. Eukaryota.
ENOG410XRUG. LUCA.
GeneTreeiENSGT00390000012080.
HOGENOMiHOG000006750.
HOVERGENiHBG052677.
InParanoidiP57740.
KOiK14301.
OMAiYLETNWT.
OrthoDBiEOG091G02HY.
PhylomeDBiP57740.
TreeFamiTF324259.

Family and domain databases

InterProiIPR007252. Nup84_Nup100.
[Graphical view]
PANTHERiPTHR13003. PTHR13003. 1 hit.
PfamiPF04121. Nup84_Nup100. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P57740-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDRSGFGEIS SPVIREAEVT RTARKQSAQK RVLLQASQDE NFGNTTPRNQ
60 70 80 90 100
VIPRTPSSFR QPFTPTSRSL LRQPDISCIL GTGGKSPRLT QSSGFFGNLS
110 120 130 140 150
MVTNLDDSNW AAAFSSQRSG LFTNTEPHSI TEDVTISAVM LREDDPGEAA
160 170 180 190 200
SMSMFSDFLQ SFLKHSSSTV FDLVEEYENI CGSQVNILSK IVSRATPGLQ
210 220 230 240 250
KFSKTASMLW LLQQEMVTWR LLASLYRDRI QSALEEESVF AVTAVNASEK
260 270 280 290 300
TVVEALFQRD SLVRQSQLVV DWLESIAKDE IGEFSDNIEF YAKSVYWENT
310 320 330 340 350
LHTLKQRQLT SYVGSVRPLV TELDPDAPIR QKMPLDDLDR EDEVRLLKYL
360 370 380 390 400
FTLIRAGMTE EAQRLCKRCG QAWRAATLEG WKLYHDPNVN GGTELEPVEG
410 420 430 440 450
NPYRRIWKIS CWRMAEDELF NRYERAIYAA LSGNLKQLLP VCDTWEDTVW
460 470 480 490 500
AYFRVMVDSL VEQEIQTSVA TLDETEELPR EYLGANWTLE KVFEELQATD
510 520 530 540 550
KKRVLEENQE HYHIVQKFLI LGDIDGLMDE FSKWLSKSRN NLPGHLLRFM
560 570 580 590 600
THLILFFRTL GLQTKEEVSI EVLKTYIQLL IREKHTNLIA FYTCHLPQDL
610 620 630 640 650
AVAQYALFLE SVTEFEQRHH CLELAKEADL DVATITKTVV ENIRKKDNGE
660 670 680 690 700
FSHHDLAPAL DTGTTEEDRL KIDVIDWLVF DPAQRAEALK QGNAIMRKFL
710 720 730 740 750
ASKKHEAAKE VFVKIPQDSI AEIYNQCEEQ GMESPLPAED DNAIREHLCI
760 770 780 790 800
RAYLEAHETF NEWFKHMNSV PQKPALIPQP TFTEKVAHEH KEKKYEMDFG
810 820 830 840 850
IWKGHLDALT ADVKEKMYNV LLFVDGGWMV DVREDAKEDH ERTHQMVLLR
860 870 880 890 900
KLCLPMLCFL LHTILHSTGQ YQECLQLADM VSSERHKLYL VFSKEELRKL
910 920
LQKLRESSLM LLDQGLDPLG YEIQL
Length:925
Mass (Da):106,374
Last modified:January 11, 2001 - v1
Checksum:iCE1E4DA6C832A5A5
GO
Isoform 2 (identifier: P57740-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-63: MDRSGFGEIS...RTPSSFRQPF → MKILVILHQETRLSLELLAHFDSLVLSTNLLFIV

Note: No experimental confirmation available.
Show »
Length:896
Mass (Da):103,175
Checksum:i5F39C26B982CE197
GO
Isoform 3 (identifier: P57740-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-151: Missing.
     579-666: Missing.

Note: No experimental confirmation available.
Show »
Length:686
Mass (Da):79,971
Checksum:iBC61E0588F57AA4B
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti845 – 8451Q → R in AAH43343 (PubMed:15489334).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti157 – 1571D → Y in NPHS11; no effect on interaction with NUP133; no effect on localization to the nuclear pore. 1 Publication
VAR_076358
Natural varianti831 – 8311D → A in NPHS11; decreased interaction with NUP133; changed localization to the nuclear pore with relocalization to the cytoplasm. 1 Publication
VAR_076359

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 151151Missing in isoform 3. 1 PublicationVSP_054262Add
BLAST
Alternative sequencei1 – 6363MDRSG…FRQPF → MKILVILHQETRLSLELLAH FDSLVLSTNLLFIV in isoform 2. 1 PublicationVSP_054263Add
BLAST
Alternative sequencei579 – 66688Missing in isoform 3. 1 PublicationVSP_054264Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ295745 mRNA. Translation: CAC03716.1.
AK302773 mRNA. Translation: BAG63979.1.
AC090061 Genomic DNA. No translation available.
AC124890 Genomic DNA. No translation available.
BC017167 mRNA. Translation: AAH17167.1.
BC043343 mRNA. Translation: AAH43343.1.
CCDSiCCDS8985.1. [P57740-1]
RefSeqiNP_065134.1. NM_020401.2. [P57740-1]
XP_011536878.1. XM_011538576.1. [P57740-2]
UniGeneiHs.524574.

Genome annotation databases

EnsembliENST00000229179; ENSP00000229179; ENSG00000111581. [P57740-1]
ENST00000378905; ENSP00000368185; ENSG00000111581. [P57740-3]
ENST00000539906; ENSP00000441448; ENSG00000111581. [P57740-2]
GeneIDi57122.
KEGGihsa:57122.
UCSCiuc001suf.4. human. [P57740-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ295745 mRNA. Translation: CAC03716.1.
AK302773 mRNA. Translation: BAG63979.1.
AC090061 Genomic DNA. No translation available.
AC124890 Genomic DNA. No translation available.
BC017167 mRNA. Translation: AAH17167.1.
BC043343 mRNA. Translation: AAH43343.1.
CCDSiCCDS8985.1. [P57740-1]
RefSeqiNP_065134.1. NM_020401.2. [P57740-1]
XP_011536878.1. XM_011538576.1. [P57740-2]
UniGeneiHs.524574.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3CQCX-ray2.53A658-925[»]
3CQGX-ray3.00A658-771[»]
A802-925[»]
3I4RX-ray3.53A658-925[»]
5A9Qelectron microscopy23.004/D/M/V1-925[»]
ProteinModelPortaliP57740.
SMRiP57740. Positions 324-580, 667-924.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121386. 103 interactions.
IntActiP57740. 71 interactions.
MINTiMINT-3021765.
STRINGi9606.ENSP00000229179.

Protein family/group databases

TCDBi1.I.1.1.3. the nuclear pore complex (npc) family.

PTM databases

iPTMnetiP57740.
PhosphoSiteiP57740.
SwissPalmiP57740.

Polymorphism and mutation databases

BioMutaiNUP107.
DMDMi12230339.

Proteomic databases

EPDiP57740.
MaxQBiP57740.
PaxDbiP57740.
PeptideAtlasiP57740.
PRIDEiP57740.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000229179; ENSP00000229179; ENSG00000111581. [P57740-1]
ENST00000378905; ENSP00000368185; ENSG00000111581. [P57740-3]
ENST00000539906; ENSP00000441448; ENSG00000111581. [P57740-2]
GeneIDi57122.
KEGGihsa:57122.
UCSCiuc001suf.4. human. [P57740-1]

Organism-specific databases

CTDi57122.
GeneCardsiNUP107.
HGNCiHGNC:29914. NUP107.
HPAiHPA024141.
HPA031679.
MIMi607617. gene.
616730. phenotype.
neXtProtiNX_P57740.
PharmGKBiPA134890486.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1964. Eukaryota.
ENOG410XRUG. LUCA.
GeneTreeiENSGT00390000012080.
HOGENOMiHOG000006750.
HOVERGENiHBG052677.
InParanoidiP57740.
KOiK14301.
OMAiYLETNWT.
OrthoDBiEOG091G02HY.
PhylomeDBiP57740.
TreeFamiTF324259.

Enzyme and pathway databases

ReactomeiR-HSA-1169408. ISG15 antiviral mechanism.
R-HSA-159236. Transport of Mature mRNA derived from an Intron-Containing Transcript.
R-HSA-165054. Rev-mediated nuclear export of HIV RNA.
R-HSA-168276. NS1 Mediated Effects on Host Pathways.
R-HSA-168325. Viral Messenger RNA Synthesis.
R-HSA-170822. Regulation of Glucokinase by Glucokinase Regulatory Protein.
R-HSA-180746. Nuclear import of Rev protein.
R-HSA-180910. Vpr-mediated nuclear import of PICs.
R-HSA-2467813. Separation of Sister Chromatids.
R-HSA-2500257. Resolution of Sister Chromatid Cohesion.
R-HSA-3108214. SUMOylation of DNA damage response and repair proteins.
R-HSA-3301854. Nuclear Pore Complex (NPC) Disassembly.
R-HSA-3371453. Regulation of HSF1-mediated heat shock response.
R-HSA-4570464. SUMOylation of RNA binding proteins.
R-HSA-4615885. SUMOylation of DNA replication proteins.
R-HSA-5578749. Transcriptional regulation by small RNAs.
R-HSA-5663220. RHO GTPases Activate Formins.
R-HSA-6784531. tRNA processing in the nucleus.
R-HSA-68877. Mitotic Prometaphase.

Miscellaneous databases

ChiTaRSiNUP107. human.
EvolutionaryTraceiP57740.
GeneWikiiNUP107.
GenomeRNAii57122.
PROiP57740.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000111581.
CleanExiHS_NUP107.
ExpressionAtlasiP57740. baseline and differential.
GenevisibleiP57740. HS.

Family and domain databases

InterProiIPR007252. Nup84_Nup100.
[Graphical view]
PANTHERiPTHR13003. PTHR13003. 1 hit.
PfamiPF04121. Nup84_Nup100. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiNU107_HUMAN
AccessioniPrimary (citable) accession number: P57740
Secondary accession number(s): B4DZ67, Q6PJE1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 11, 2001
Last sequence update: January 11, 2001
Last modified: September 7, 2016
This is version 144 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.