Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P57727 (TMPS3_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 140. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Transmembrane protease serine 3

EC=3.4.21.-
Alternative name(s):
Serine protease TADG-12
Tumor-associated differentially-expressed gene 12 protein
Gene names
Name:TMPRSS3
Synonyms:ECHOS1, TADG12
ORF Names:UNQ323/PRO382
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length454 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Probable serine protease that play a role in hearing. Acts as a permissive factor for cochlear hair cells survival and activation at the onset of hearing and is required for saccular hair cell survival By similarity. Activates ENaC (in vitro). Ref.9

Subcellular location

Endoplasmic reticulum membrane; Single-pass type II membrane protein Ref.9.

Tissue specificity

Expressed in many tissues including fetal cochlea. Isoform T is found at increased levels in some carcinomas.

Post-translational modification

Undergoes autoproteolytic activation.

Involvement in disease

Deafness, autosomal recessive, 8 (DFNB8) [MIM:601072]: A form of non-syndromic sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information.
Note: The disease is caused by mutations affecting the gene represented in this entry.

Sequence similarities

Belongs to the peptidase S1 family.

Contains 1 LDL-receptor class A domain.

Contains 1 peptidase S1 domain.

Contains 1 SRCR domain.

Alternative products

This entry describes 6 isoforms produced by alternative splicing. [Align] [Select]
Isoform A (identifier: P57727-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform B (identifier: P57727-2)

Also known as: C;

The sequence of this isoform differs from the canonical sequence as follows:
     1-127: Missing.
Isoform D (identifier: P57727-3)

The sequence of this isoform differs from the canonical sequence as follows:
     318-454: EMIQPVCLPN...HEQMERDLKT → GTSGSLCGSAALPLFQEDLQLLIEAFL
Isoform T (identifier: P57727-4)

Also known as: Truncated; TADG-12V;

The sequence of this isoform differs from the canonical sequence as follows:
     261-293: DLYLPKSWTIQVGLVSLLDNPAPSHLVEKIVYH → EIVAPRERADRRGRKLLCWRKPTKMKGPRPSHS
     294-454: Missing.
Isoform E (identifier: P57727-5)

The sequence of this isoform differs from the canonical sequence as follows:
     350-350: Missing.
Isoform 6 (identifier: P57727-6)

Also known as: TMPRSS3e;

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MQAVGPKPLP...DVRGPEIVTM
Note: Has a predicted N-terminal signal sequence, indicating it may be secreted. Expressed in retina, lung, liver, pancreas, placenta and kidney.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 454454Transmembrane protease serine 3
PRO_0000088690

Regions

Topological domain1 – 4848Cytoplasmic Potential
Transmembrane49 – 6921Helical; Signal-anchor for type II membrane protein; Potential
Topological domain70 – 454385Extracellular Potential
Domain72 – 10837LDL-receptor class A
Domain109 – 20597SRCR
Domain217 – 449233Peptidase S1

Sites

Active site2571Charge relay system By similarity
Active site3041Charge relay system By similarity
Active site4011Charge relay system Probable
Site216 – 2172Cleavage Potential

Amino acid modifications

Glycosylation2211N-linked (GlcNAc...) Potential
Disulfide bond73 ↔ 85 By similarity
Disulfide bond79 ↔ 98 By similarity
Disulfide bond92 ↔ 107 By similarity
Disulfide bond129 ↔ 194 By similarity
Disulfide bond142 ↔ 204 By similarity
Disulfide bond207 ↔ 324 By similarity
Disulfide bond242 ↔ 258 By similarity
Disulfide bond338 ↔ 407 By similarity
Disulfide bond370 ↔ 386 By similarity
Disulfide bond397 ↔ 425 By similarity

Natural variations

Alternative sequence1 – 127127Missing in isoform B.
VSP_005391
Alternative sequence11M → MQAVGPKPLPTLLCGGRTGH RTARVLSFLIRSCPCEPGKG CVYGKPVTLWPTISSVVPST FLGLGNYEVEVEAEPDVRGP EIVTM in isoform 6.
VSP_047695
Alternative sequence261 – 29333DLYLP…KIVYH → EIVAPRERADRRGRKLLCWR KPTKMKGPRPSHS in isoform T.
VSP_005393
Alternative sequence294 – 454161Missing in isoform T.
VSP_005394
Alternative sequence318 – 454137EMIQP…RDLKT → GTSGSLCGSAALPLFQEDLQ LLIEAFL in isoform D.
VSP_005392
Alternative sequence3501Missing in isoform E.
VSP_013184
Natural variant531V → I. Ref.2 Ref.11
Corresponds to variant rs928302 [ dbSNP | Ensembl ].
VAR_010781
Natural variant1031D → G in DFBN8; fails to undergo proteolytic cleavage and is unable to activate ENaC. Ref.9 Ref.12
VAR_013490
Natural variant1091R → W in DFBN8; fails to undergo proteolytic cleavage and is unable to activate ENaC. Ref.9 Ref.11
VAR_013491
Natural variant1111G → S. Ref.11
Corresponds to variant rs35227181 [ dbSNP | Ensembl ].
VAR_013492
Natural variant1731D → N. Ref.12
VAR_013493
Natural variant1941C → F in DFBN8; fails to undergo proteolytic cleavage and is unable to activate ENaC. Ref.9 Ref.11
VAR_013494
Natural variant2161R → L in DFBN8; fails to undergo proteolytic cleavage and is unable to activate ENaC. Ref.13
Corresponds to variant rs137853000 [ dbSNP | Ensembl ].
VAR_025354
Natural variant2511W → C in DFBN8; fails to undergo proteolytic cleavage and is unable to activate ENaC. Ref.9 Ref.10
VAR_011678
Natural variant2531I → V. Ref.11
Corresponds to variant rs2839500 [ dbSNP | Ensembl ].
VAR_013101
Natural variant4041P → L in DFBN8; fails to undergo proteolytic cleavage and is unable to activate ENaC. Ref.9 Ref.10 Ref.13
VAR_011679
Natural variant4071C → R in DFBN8; fails to undergo proteolytic cleavage and is unable to activate ENaC. Ref.9 Ref.11
VAR_013495
Natural variant4261A → T. Ref.12
Corresponds to variant rs56264519 [ dbSNP | Ensembl ].
VAR_013496

Experimental info

Mutagenesis4011S → A: Fails to undergo proteolytic cleavage and is unable to activate ENaC. Ref.9
Sequence conflict46 – 549LKFFPIIVI → FEVFSQSSSL in AAG37012. Ref.1
Sequence conflict901A → T in AAG37012. Ref.1
Sequence conflict369 – 39527ICNHR…TGGVD → DLQPQGRVRWHHLPLHALRG LPDGWRWN in AAG37012. Ref.1
Sequence conflict4271E → D in AAG37012. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform A [UniParc].

Last modified February 21, 2001. Version 2.
Checksum: 57ECC3678F7D6AFF

FASTA45449,405
        10         20         30         40         50         60 
MGENDPPAVE APFSFRSLFG LDDLKISPVA PDADAVAAQI LSLLPLKFFP IIVIGIIALI 

        70         80         90        100        110        120 
LALAIGLGIH FDCSGKYRCR SSFKCIELIA RCDGVSDCKD GEDEYRCVRV GGQNAVLQVF 

       130        140        150        160        170        180 
TAASWKTMCS DDWKGHYANV ACAQLGFPSY VSSDNLRVSS LEGQFREEFV SIDHLLPDDK 

       190        200        210        220        230        240 
VTALHHSVYV REGCASGHVV TLQCTACGHR RGYSSRIVGG NMSLLSQWPW QASLQFQGYH 

       250        260        270        280        290        300 
LCGGSVITPL WIITAAHCVY DLYLPKSWTI QVGLVSLLDN PAPSHLVEKI VYHSKYKPKR 

       310        320        330        340        350        360 
LGNDIALMKL AGPLTFNEMI QPVCLPNSEE NFPDGKVCWT SGWGATEDGA GDASPVLNHA 

       370        380        390        400        410        420 
AVPLISNKIC NHRDVYGGII SPSMLCAGYL TGGVDSCQGD SGGPLVCQER RLWKLVGATS 

       430        440        450 
FGIGCAEVNK PGVYTRVTSF LDWIHEQMER DLKT 

« Hide

Isoform B (C) [UniParc].

Checksum: CF6A6505C4B9A6B9
Show »

FASTA32735,760
Isoform D [UniParc].

Checksum: FCE5335794AF9712
Show »

FASTA34437,497
Isoform T (Truncated) (TADG-12V) [UniParc].

Checksum: CF9C0540F570B900
Show »

FASTA29332,230
Isoform E [UniParc].

Checksum: 90D46870BFA39B86
Show »

FASTA45349,334
Isoform 6 (TMPRSS3e) [UniParc].

Checksum: EC7E6FDAA5B7ED9B
Show »

FASTA53858,324

References

« Hide 'large scale' references
[1]"Ovarian tumor cells express a novel multi-domain cell surface serine protease."
Underwood L.J., Shigemasa K., Tanimoto H., Beard J.B., Schneider E.N., Wang Y., Parmley T.H., O'Brien T.J.
Biochim. Biophys. Acta 1502:337-350(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A; E AND T).
Tissue: Ovarian carcinoma.
[2]"Insertion of beta-satellite repeats identifies a transmembrane protease causing both congenital and childhood onset autosomal recessive deafness."
Scott H.S., Kudoh J., Wattenhofer M., Shibuya K., Berry A., Chrast R., Guipponi M., Wang J., Kawasaki K., Asakawa S., Minoshima S., Younus F., Mehdi S.Q., Radhakrishna U., Papasavvas M.P., Gehrig C., Rossier C., Korostishevsky M. expand/collapse author list , Gal A., Shimizu N., Bonne-Tamir B., Antonarakis S.E.
Nat. Genet. 27:59-63(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A; B AND D), VARIANT ILE-53.
[3]"Characterization of a new full length TMPRSS3 isoform and identification of mutant alleles responsible for nonsyndromic recessive deafness in Newfoundland and Pakistan."
Ahmed Z.M., Li X.C., Powell S.D., Riazuddin S., Young T.L., Ramzan K., Ahmad Z., Luscombe S., Dhillon K., MacLaren L., Ploplis B., Shotland L.I., Ives E., Riazuddin S., Friedman T.B., Morell R.J., Wilcox E.R.
BMC Med. Genet. 5:24-24(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 6), INVOLVEMENT IN DFBN8.
Tissue: Retina.
[4]"The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment."
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. expand/collapse author list , Heldens S., Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.
Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM E).
[5]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM E).
[6]"The DNA sequence of human chromosome 21."
Hattori M., Fujiyama A., Taylor T.D., Watanabe H., Yada T., Park H.-S., Toyoda A., Ishii K., Totoki Y., Choi D.-K., Groner Y., Soeda E., Ohki M., Takagi T., Sakaki Y., Taudien S., Blechschmidt K., Polley A. expand/collapse author list , Menzel U., Delabar J., Kumpf K., Lehmann R., Patterson D., Reichwald K., Rump A., Schillhabel M., Schudy A., Zimmermann W., Rosenthal A., Kudoh J., Shibuya K., Kawasaki K., Asakawa S., Shintani A., Sasaki T., Nagamine K., Mitsuyama S., Antonarakis S.E., Minoshima S., Shimizu N., Nordsiek G., Hornischer K., Brandt P., Scharfe M., Schoen O., Desario A., Reichelt J., Kauer G., Bloecker H., Ramser J., Beck A., Klages S., Hennig S., Riesselmann L., Dagand E., Wehrmeyer S., Borzym K., Gardiner K., Nizetic D., Francis F., Lehrach H., Reinhardt R., Yaspo M.-L.
Nature 405:311-319(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[8]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS A AND E).
Tissue: Lung.
[9]"The transmembrane serine protease (TMPRSS3) mutated in deafness DFNB8/10 activates the epithelial sodium channel (ENaC) in vitro."
Guipponi M., Vuagniaux G., Wattenhofer M., Shibuya K., Vazquez M., Dougherty L., Scamuffa N., Guida E., Okui M., Rossier C., Hancock M., Buchet K., Reymond A., Hummler E., Marzella P.L., Kudoh J., Shimizu N., Scott H.S., Antonarakis S.E., Rossier B.C.
Hum. Mol. Genet. 11:2829-2836(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: SUBCELLULAR LOCATION, AUTOCATALYTIC CLEAVAGE, MUTAGENESIS OF SER-401, CHARACTERIZATION OF VARIANTS DFBN8 GLY-103; TRP-109; PHE-194; CYS-251; LEU-404 AND ARG-407, FUNCTION IN ENAC CLEAVAGE.
[10]"Novel missense mutations of TMPRSS3 in two consanguineous Tunisian families with non-syndromic autosomal recessive deafness."
Masmoudi S., Antonarakis S.E., Schwede T., Ghorbel A.M., Gratri M., Pappasavas M.P., Drira M., Elgaied-Boulila A., Wattenhofer M., Rossier C., Scott H.S., Ayadi H., Guipponi M.
Hum. Mutat. 18:101-108(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANTS DFBN8 CYS-251 AND LEU-404.
[11]"Novel mutations of TMPRSS3 in four DFNB8/B10 families segregating congenital autosomal recessive deafness."
Ben-Yosef T., Wattenhofer M., Riazuddin S., Ahmed Z.M., Scott H.S., Kudoh J., Shibuya K., Antonarakis S.E., Bonne-Tamir B., Radhakrishna U., Naz S., Ahmed Z., Riazuddin S., Pandya A., Nance W.E., Wilcox E.R., Friedman T.B., Morell R.J.
J. Med. Genet. 38:396-400(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANTS DFBN8 TRP-109; PHE-194 AND ARG-407, VARIANTS ILE-53; SER-111 AND VAL-253.
[12]"Mutations in the TMPRSS3 gene are a rare cause of childhood nonsyndromic deafness in Caucasian patients."
Wattenhofer M., Di Iorio V., Rabionet R., Dougherty L., Pampanos A., Schwede T., Montserrat-Sentis B., Arbones L., Iliades T., Pasquadibisceglie A., D'Amelio M., Alwan S., Rossier C., Dahl H.-H.M., Petersen M.B., Estivill X., Gasparini P., Scott H.S., Antonarakis S.E.
J. Mol. Med. 80:124-131(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT DFBN8 GLY-103, VARIANTS ASN-173 AND THR-426.
[13]"A novel TMPRSS3 missense mutation in a DFNB8/10 family prevents proteolytic activation of the protein."
Wattenhofer M., Sahin-Calapoglu N., Andreasen D., Kalay E., Caylan R., Braillard B., Fowler-Jaeger N., Reymond A., Rossier B.C., Karaguzel A., Antonarakis S.E.
Hum. Genet. 117:528-535(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANTS DFBN8 LEU-216 AND LEU-404.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF201380 mRNA. Translation: AAG37012.1.
AB038157 mRNA. Translation: BAB20077.1.
AB038158 mRNA. Translation: BAB20078.1.
AB038159 mRNA. Translation: BAB20079.1.
AB038160 mRNA. Translation: BAB20080.1.
AY633572 mRNA. Translation: AAT66641.1.
AY358458 mRNA. Translation: AAQ88823.1.
AK172842 mRNA. Translation: BAD18806.1.
AP001623 Genomic DNA. No translation available.
CH471079 Genomic DNA. Translation: EAX09564.1.
CH471079 Genomic DNA. Translation: EAX09566.1.
BC074846 mRNA. Translation: AAH74846.1.
BC074847 mRNA. Translation: AAH74847.1.
RefSeqNP_001243246.1. NM_001256317.1.
NP_076927.1. NM_024022.2.
NP_115780.1. NM_032404.2.
NP_115781.1. NM_032405.1.
UniGeneHs.208600.

3D structure databases

ProteinModelPortalP57727.
SMRP57727. Positions 108-449.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid122236. 4 interactions.
IntActP57727. 3 interactions.
MINTMINT-1379704.
STRING9606.ENSP00000291532.

Protein family/group databases

MEROPSS01.079.

PTM databases

PhosphoSiteP57727.

Polymorphism databases

DMDM13124582.

Proteomic databases

PaxDbP57727.
PRIDEP57727.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000291532; ENSP00000291532; ENSG00000160183. [P57727-1]
ENST00000380399; ENSP00000369762; ENSG00000160183. [P57727-6]
ENST00000398397; ENSP00000381434; ENSG00000160183. [P57727-3]
ENST00000433957; ENSP00000411013; ENSG00000160183. [P57727-5]
GeneID64699.
KEGGhsa:64699.
UCSCuc002zay.2. human. [P57727-2]
uc002zaz.3. human. [P57727-1]
uc002zbc.3. human. [P57727-5]
uc002zbd.4. human. [P57727-3]

Organism-specific databases

CTD64699.
GeneCardsGC21M043791.
HGNCHGNC:11877. TMPRSS3.
HPAHPA031305.
MIM601072. phenotype.
605511. gene.
neXtProtNX_P57727.
Orphanet90636. Autosomal recessive nonsyndromic sensorineural deafness type DFNB.
PharmGKBPA36578.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG5640.
HOGENOMHOG000251822.
HOVERGENHBG013304.
InParanoidP57727.
KOK09634.
OMAITPLWIV.
PhylomeDBP57727.
TreeFamTF351678.

Gene expression databases

ArrayExpressP57727.
BgeeP57727.
CleanExHS_TMPRSS3.
GenevestigatorP57727.

Family and domain databases

Gene3D3.10.250.10. 1 hit.
4.10.400.10. 1 hit.
InterProIPR023415. LDLR_class-A_CS.
IPR002172. LDrepeatLR_classA_rpt.
IPR001254. Peptidase_S1.
IPR018114. Peptidase_S1_AS.
IPR001314. Peptidase_S1A.
IPR001190. SRCR.
IPR017448. SRCR-like_dom.
IPR009003. Trypsin-like_Pept_dom.
[Graphical view]
PfamPF00057. Ldl_recept_a. 1 hit.
PF00089. Trypsin. 1 hit.
[Graphical view]
PRINTSPR00722. CHYMOTRYPSIN.
SMARTSM00192. LDLa. 1 hit.
SM00202. SR. 1 hit.
SM00020. Tryp_SPc. 1 hit.
[Graphical view]
SUPFAMSSF50494. SSF50494. 1 hit.
SSF56487. SSF56487. 1 hit.
SSF57424. SSF57424. 1 hit.
PROSITEPS01209. LDLRA_1. 1 hit.
PS50068. LDLRA_2. 1 hit.
PS00420. SRCR_1. 1 hit.
PS50287. SRCR_2. 1 hit.
PS50240. TRYPSIN_DOM. 1 hit.
PS00134. TRYPSIN_HIS. 1 hit.
PS00135. TRYPSIN_SER. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiTMPRSS3.
GenomeRNAi64699.
NextBio66629.
PROP57727.
SOURCESearch...

Entry information

Entry nameTMPS3_HUMAN
AccessionPrimary (citable) accession number: P57727
Secondary accession number(s): D3DSJ6, Q5USC7, Q6ZMC3
Entry history
Integrated into UniProtKB/Swiss-Prot: January 11, 2001
Last sequence update: February 21, 2001
Last modified: April 16, 2014
This is version 140 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Peptidase families

Classification of peptidase families and list of entries

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 21

Human chromosome 21: entries, gene names and cross-references to MIM