P57727 (TMPS3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 131.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Transmembrane protease serine 3 EC=3.4.21.- Alternative name(s): Serine protease TADG-12 Tumor-associated differentially-expressed gene 12 protein | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 454 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Probable serine protease that play a role in hearing. Acts as a permissive factor for cochlear hair cells survival and activation at the onset of hearing and is required for saccular hair cell survival By similarity. Activates ENaC (in vitro). Ref.7 |
| Subcellular location | Endoplasmic reticulum membrane; Single-pass type II membrane protein Ref.7. |
| Tissue specificity | Expressed in many tissues including fetal cochlea. Isoform T is found at increased levels in some carcinomas. |
| Post-translational modification | Undergoes autoproteolytic activation. |
| Involvement in disease | Deafness, autosomal recessive, 8 (DFNB8) [MIM:601072]: A form of non-syndromic sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information. |
| Sequence similarities | Belongs to the peptidase S1 family. Contains 1 LDL-receptor class A domain. Contains 1 peptidase S1 domain. Contains 1 SRCR domain. |
Ontologies
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform A (identifier: P57727-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform B (identifier: P57727-2) Also known as: C; The sequence of this isoform differs from the canonical sequence as follows: 1-127: Missing. | ||||||
| Isoform D (identifier: P57727-3) The sequence of this isoform differs from the canonical sequence as follows: 318-454: EMIQPVCLPN...HEQMERDLKT → GTSGSLCGSAALPLFQEDLQLLIEAFL | ||||||
| Isoform T (identifier: P57727-4) Also known as: Truncated; TADG-12V; The sequence of this isoform differs from the canonical sequence as follows: 261-293: DLYLPKSWTIQVGLVSLLDNPAPSHLVEKIVYH → EIVAPRERADRRGRKLLCWRKPTKMKGPRPSHS 294-454: Missing. | ||||||
| Isoform E (identifier: P57727-5) The sequence of this isoform differs from the canonical sequence as follows: 350-350: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 454 | 454 | Transmembrane protease serine 3 | PRO_0000088690 | |||||||
Regions | |||||||||||
| Topological domain | 1 – 48 | 48 | Cytoplasmic Potential | ||||||||
| Transmembrane | 49 – 69 | 21 | Helical; Signal-anchor for type II membrane protein; Potential | ||||||||
| Topological domain | 70 – 454 | 385 | Extracellular Potential | ||||||||
| Domain | 72 – 108 | 37 | LDL-receptor class A | ||||||||
| Domain | 109 – 205 | 97 | SRCR | ||||||||
| Domain | 217 – 449 | 233 | Peptidase S1 | ||||||||
Sites | |||||||||||
| Active site | 257 | 1 | Charge relay system By similarity | ||||||||
| Active site | 304 | 1 | Charge relay system By similarity | ||||||||
| Active site | 401 | 1 | Charge relay system Probable | ||||||||
| Site | 216 – 217 | 2 | Cleavage Potential | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 221 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 73 ↔ 85 | By similarity | |||||||||
| Disulfide bond | 79 ↔ 98 | By similarity | |||||||||
| Disulfide bond | 92 ↔ 107 | By similarity | |||||||||
| Disulfide bond | 129 ↔ 194 | By similarity | |||||||||
| Disulfide bond | 142 ↔ 204 | By similarity | |||||||||
| Disulfide bond | 207 ↔ 324 | By similarity | |||||||||
| Disulfide bond | 242 ↔ 258 | By similarity | |||||||||
| Disulfide bond | 338 ↔ 407 | By similarity | |||||||||
| Disulfide bond | 370 ↔ 386 | By similarity | |||||||||
| Disulfide bond | 397 ↔ 425 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 127 | 127 | Missing in isoform B. | VSP_005391 | |||||||
| Alternative sequence | 261 – 293 | 33 | DLYLP…KIVYH → EIVAPRERADRRGRKLLCWR KPTKMKGPRPSHS in isoform T. | VSP_005393 | |||||||
| Alternative sequence | 294 – 454 | 161 | Missing in isoform T. | VSP_005394 | |||||||
| Alternative sequence | 318 – 454 | 137 | EMIQP…RDLKT → GTSGSLCGSAALPLFQEDLQ LLIEAFL in isoform D. | VSP_005392 | |||||||
| Alternative sequence | 350 | 1 | Missing in isoform E. | VSP_013184 | |||||||
| Natural variant | 53 | 1 | V → I. Ref.2 Ref.9 Corresponds to variant rs928302 [ dbSNP | Ensembl ]. | VAR_010781 | |||||||
| Natural variant | 103 | 1 | D → G in DFBN8; fails to undergo proteolytic cleavage and is unable to activate ENaC. Ref.7 Ref.10 | VAR_013490 | |||||||
| Natural variant | 109 | 1 | R → W in DFBN8; fails to undergo proteolytic cleavage and is unable to activate ENaC. Ref.7 Ref.9 | VAR_013491 | |||||||
| Natural variant | 111 | 1 | G → S. Ref.9 Corresponds to variant rs35227181 [ dbSNP | Ensembl ]. | VAR_013492 | |||||||
| Natural variant | 173 | 1 | D → N. Ref.10 | VAR_013493 | |||||||
| Natural variant | 194 | 1 | C → F in DFBN8; fails to undergo proteolytic cleavage and is unable to activate ENaC. Ref.7 Ref.9 | VAR_013494 | |||||||
| Natural variant | 216 | 1 | R → L in DFBN8; fails to undergo proteolytic cleavage and is unable to activate ENaC. Ref.11 | VAR_025354 | |||||||
| Natural variant | 251 | 1 | W → C in DFBN8; fails to undergo proteolytic cleavage and is unable to activate ENaC. Ref.7 Ref.8 | VAR_011678 | |||||||
| Natural variant | 253 | 1 | I → V. Ref.9 Corresponds to variant rs2839500 [ dbSNP | Ensembl ]. | VAR_013101 | |||||||
| Natural variant | 404 | 1 | P → L in DFBN8; fails to undergo proteolytic cleavage and is unable to activate ENaC. Ref.7 Ref.8 Ref.11 | VAR_011679 | |||||||
| Natural variant | 407 | 1 | C → R in DFBN8; fails to undergo proteolytic cleavage and is unable to activate ENaC. Ref.7 Ref.9 | VAR_013495 | |||||||
| Natural variant | 426 | 1 | A → T. Ref.10 Corresponds to variant rs56264519 [ dbSNP | Ensembl ]. | VAR_013496 | |||||||
Experimental info | |||||||||||
| Mutagenesis | 401 | 1 | S → A: Fails to undergo proteolytic cleavage and is unable to activate ENaC. Ref.7 | ||||||||
| Sequence conflict | 46 – 54 | 9 | LKFFPIIVI → FEVFSQSSSL in AAG37012. Ref.1 | ||||||||
| Sequence conflict | 90 | 1 | A → T in AAG37012. Ref.1 | ||||||||
| Sequence conflict | 369 – 395 | 27 | ICNHR…TGGVD → DLQPQGRVRWHHLPLHALRG LPDGWRWN in AAG37012. Ref.1 | ||||||||
| Sequence conflict | 427 | 1 | E → D in AAG37012. Ref.1 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Ovarian tumor cells express a novel multi-domain cell surface serine protease." Underwood L.J., Shigemasa K., Tanimoto H., Beard J.B., Schneider E.N., Wang Y., Parmley T.H., O'Brien T.J. Biochim. Biophys. Acta 1502:337-350(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A; E AND T). Tissue: Ovarian carcinoma. |
| [2] | "Insertion of beta-satellite repeats identifies a transmembrane protease causing both congenital and childhood onset autosomal recessive deafness." Scott H.S., Kudoh J., Wattenhofer M., Shibuya K., Berry A., Chrast R., Guipponi M., Wang J., Kawasaki K., Asakawa S., Minoshima S., Younus F., Mehdi S.Q., Radhakrishna U., Papasavvas M.P., Gehrig C., Rossier C., Korostishevsky M. Antonarakis S.E.Nat. Genet. 27:59-63(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A; B AND D), VARIANT ILE-53. |
| [3] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM E). |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM E). |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS A AND E). Tissue: Lung. |
| [7] | "The transmembrane serine protease (TMPRSS3) mutated in deafness DFNB8/10 activates the epithelial sodium channel (ENaC) in vitro." Guipponi M., Vuagniaux G., Wattenhofer M., Shibuya K., Vazquez M., Dougherty L., Scamuffa N., Guida E., Okui M., Rossier C., Hancock M., Buchet K., Reymond A., Hummler E., Marzella P.L., Kudoh J., Shimizu N., Scott H.S., Antonarakis S.E., Rossier B.C. Hum. Mol. Genet. 11:2829-2836(2002) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, AUTOCATALYTIC CLEAVAGE, MUTAGENESIS OF SER-401, CHARACTERIZATION OF VARIANTS DFBN8 GLY-103; TRP-109; PHE-194; CYS-251; LEU-404 AND ARG-407, FUNCTION IN ENAC CLEAVAGE. |
| [8] | "Novel missense mutations of TMPRSS3 in two consanguineous Tunisian families with non-syndromic autosomal recessive deafness." Masmoudi S., Antonarakis S.E., Schwede T., Ghorbel A.M., Gratri M., Pappasavas M.P., Drira M., Elgaied-Boulila A., Wattenhofer M., Rossier C., Scott H.S., Ayadi H., Guipponi M. Hum. Mutat. 18:101-108(2001) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS DFBN8 CYS-251 AND LEU-404. |
| [9] | "Novel mutations of TMPRSS3 in four DFNB8/B10 families segregating congenital autosomal recessive deafness." Ben-Yosef T., Wattenhofer M., Riazuddin S., Ahmed Z.M., Scott H.S., Kudoh J., Shibuya K., Antonarakis S.E., Bonne-Tamir B., Radhakrishna U., Naz S., Ahmed Z., Riazuddin S., Pandya A., Nance W.E., Wilcox E.R., Friedman T.B., Morell R.J. J. Med. Genet. 38:396-400(2001) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS DFBN8 TRP-109; PHE-194 AND ARG-407, VARIANTS ILE-53; SER-111 AND VAL-253. |
| [10] | "Mutations in the TMPRSS3 gene are a rare cause of childhood nonsyndromic deafness in Caucasian patients." Wattenhofer M., Di Iorio V., Rabionet R., Dougherty L., Pampanos A., Schwede T., Montserrat-Sentis B., Arbones L., Iliades T., Pasquadibisceglie A., D'Amelio M., Alwan S., Rossier C., Dahl H.-H.M., Petersen M.B., Estivill X., Gasparini P., Scott H.S., Antonarakis S.E. J. Mol. Med. 80:124-131(2002) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT DFBN8 GLY-103, VARIANTS ASN-173 AND THR-426. |
| [11] | "A novel TMPRSS3 missense mutation in a DFNB8/10 family prevents proteolytic activation of the protein." Wattenhofer M., Sahin-Calapoglu N., Andreasen D., Kalay E., Caylan R., Braillard B., Fowler-Jaeger N., Reymond A., Rossier B.C., Karaguzel A., Antonarakis S.E. Hum. Genet. 117:528-535(2005) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS DFBN8 LEU-216 AND LEU-404. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF201380 mRNA. Translation: AAG37012.1. AB038157 mRNA. Translation: BAB20077.1. AB038158 mRNA. Translation: BAB20078.1. AB038159 mRNA. Translation: BAB20079.1. AB038160 mRNA. Translation: BAB20080.1. AK172842 mRNA. Translation: BAD18806.1. AY358458 mRNA. Translation: AAQ88823.1. CH471079 Genomic DNA. Translation: EAX09564.1. CH471079 Genomic DNA. Translation: EAX09566.1. BC074846 mRNA. Translation: AAH74846.1. BC074847 mRNA. Translation: AAH74847.1. |
| IPI | IPI00027977. IPI00220533. IPI00220534. IPI00743692. IPI01010471. |
| RefSeq | NP_001243246.1. NM_001256317.1. NP_076927.1. NM_024022.2. NP_115780.1. NM_032404.2. NP_115781.1. NM_032405.1. |
| UniGene | Hs.208600. |
3D structure databases | |
| ProteinModelPortal | P57727. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P57727. 3 interactions. |
| MINT | MINT-1379704. |
| STRING | 9606.ENSP00000291532. |
Protein family/group databases | |
| MEROPS | S01.079. |
PTM databases | |
| PhosphoSite | P57727. |
Polymorphism databases | |
| DMDM | 13124582. |
Proteomic databases | |
| PaxDb | P57727. |
| PRIDE | P57727. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000291532; ENSP00000291532; ENSG00000160183. ENST00000398397; ENSP00000381434; ENSG00000160183. ENST00000433957; ENSP00000411013; ENSG00000160183. |
| GeneID | 64699. |
| KEGG | hsa:64699. |
| UCSC | uc002zay.2. human. uc002zaz.2. human. uc002zbc.2. human. uc002zbd.3. human. |
Organism-specific databases | |
| CTD | 64699. |
| GeneCards | GC21M038437. |
| HGNC | HGNC:11877. TMPRSS3. |
| HPA | HPA031305. |
| MIM | 601072. phenotype. 605511. gene. |
| neXtProt | NX_P57727. |
| Orphanet | 90636. Autosomal recessive nonsyndromic sensorineural deafness type DFNB. |
| PharmGKB | PA36578. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG5640. |
| HOGENOM | HOG000251822. |
| HOVERGEN | HBG013304. |
| InParanoid | P57727. |
| KO | K09634. |
| OrthoDB | EOG4XH002. |
| PhylomeDB | P57727. |
Gene expression databases | |
| ArrayExpress | P57727. |
| Bgee | P57727. |
| CleanEx | HS_TMPRSS3. |
| Genevestigator | P57727. |
| GermOnline | ENSG00000160183. Homo sapiens. |
Family and domain databases | |
| Gene3D | 4.10.400.10. 1 hit. |
| InterPro | IPR023415. LDLR_class-A_CS. IPR002172. LDrepeatLR_classA_rpt. IPR001254. Peptidase_S1. IPR018114. Peptidase_S1_AS. IPR001314. Peptidase_S1A. IPR001190. Srcr_rcpt. IPR017448. Srcr_rcpt-rel. IPR009003. Trypsin-like_Pept_dom. [Graphical view] |
| Pfam | PF00057. Ldl_recept_a. 1 hit. PF00530. SRCR. 1 hit. PF00089. Trypsin. 1 hit. [Graphical view] |
| PRINTS | PR00722. CHYMOTRYPSIN. |
| SMART | SM00192. LDLa. 1 hit. SM00202. SR. 1 hit. SM00020. Tryp_SPc. 1 hit. [Graphical view] |
| SUPFAM | SSF57424. LDL_rcpt_classA_cys-rich. 1 hit. SSF50494. Pept_Ser_Cys. 1 hit. SSF56487. Srcr_receptor. 1 hit. |
| PROSITE | PS01209. LDLRA_1. 1 hit. PS50068. LDLRA_2. 1 hit. PS00420. SRCR_1. 1 hit. PS50287. SRCR_2. 1 hit. PS50240. TRYPSIN_DOM. 1 hit. PS00134. TRYPSIN_HIS. 1 hit. PS00135. TRYPSIN_SER. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 64699. |
| NextBio | 66629. |
| SOURCE | Search... |
Entry information
| Entry name | TMPS3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P57727 Secondary accession number(s): D3DSJ6, Q6ZMC3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Peptidase families Classification of peptidase families and list of entries |
| Human chromosome 21 Human chromosome 21: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
