P57075 (UBS3A_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 99.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Ubiquitin-associated and SH3 domain-containing protein A Alternative name(s): Cbl-interacting protein 4 Short name=CLIP4 Suppressor of T-cell receptor signaling 2 Short name=STS-2 T-cell ubiquitin ligand 1 Short name=TULA-1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 661 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Interferes with CBL-mediated down-regulation and degradation of receptor-type tyrosine kinases. Promotes accumulation of activated target receptors, such as T-cell receptors, EGFR and PDGFRB, on the cell surface. Exhibits negligigle protein tyrosine phosphatase activity at neutral pH. May act as a dominant-negative regulator of UBASH3B-dependent dephosphorylation. May inhibit dynamin-dependent endocytic pathways by functionally sequestering dynamin via its SH3 domain. Ref.5 Ref.6 Ref.7 |
| Subunit structure | Homodimer or homooligomer. Interacts with CBL. Part of a complex containing CBL and activated EGFR. Interacts with ubiquitin and with mono-ubiquitinated proteins. Interacts with dynamin. Ref.2 Ref.5 Ref.6 |
| Subcellular location | |
| Tissue specificity | Highest expression of UBASH3A in tissues belonging to the immune system, including spleen, peripheral blood leukocytes, thymus and bone marrow. Ref.1 Ref.2 |
| Sequence similarities | Contains 1 SH3 domain. Contains 1 UBA domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | SH3 domain |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular component | cytosol Inferred from direct assay. Source: UniProtKB nucleusInferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P57075-1) Also known as: Long; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P57075-2) Also known as: Short; The sequence of this isoform differs from the canonical sequence as follows: 185-223: GTSVSRFWIFSQVPGHGPNLRLSNLTRASFVSHYILQKY → D |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||
Molecule processing | ||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 661 | 661 | Ubiquitin-associated and SH3 domain-containing protein A | PRO_0000210994 | ||||||||||||
Regions | ||||||||||||||||
| Domain | 15 – 60 | 46 | UBA | |||||||||||||
| Domain | 276 – 340 | 65 | SH3 | |||||||||||||
| Region | 395 – 661 | 267 | Phosphatase-like | |||||||||||||
Natural variations | ||||||||||||||||
| Alternative sequence | 185 – 223 | 39 | GTSVS…ILQKY → D in isoform 2. | VSP_006703 | ||||||||||||
| Natural variant | 18 | 1 | S → G. Ref.4 Corresponds to variant rs2277798 [ dbSNP | Ensembl ]. | VAR_026971 | ||||||||||||
| Natural variant | 28 | 1 | L → F. Ref.4 Corresponds to variant rs2277800 [ dbSNP | Ensembl ]. | VAR_026972 | ||||||||||||
| Natural variant | 286 | 1 | Q → R. Corresponds to variant rs13048049 [ dbSNP | Ensembl ]. | VAR_026973 | ||||||||||||
| Natural variant | 324 | 1 | R → L. Corresponds to variant rs13048049 [ dbSNP | Ensembl ]. | VAR_061921 | ||||||||||||
| Natural variant | 324 | 1 | R → Q. Corresponds to variant rs13048049 [ dbSNP | Ensembl ]. | VAR_061922 | ||||||||||||
| Natural variant | 466 | 1 | D → E. Corresponds to variant rs17114930 [ dbSNP | Ensembl ]. | VAR_052675 | ||||||||||||
Experimental info | ||||||||||||||||
| Mutagenesis | 317 | 1 | W → A: Loss of interaction with CBL. Ref.5 Ref.6 | |||||||||||||
| Mutagenesis | 317 | 1 | W → L: Abolishes binding to dynamin. Ref.5 Ref.6 | |||||||||||||
| Sequence conflict | 64 | 1 | P → H in AAH69511. Ref.4 | |||||||||||||
| Sequence conflict | 229 | 1 | C → Y in AAH69511. Ref.4 | |||||||||||||
| Sequence conflict | 283 | 1 | A → V in AAH69483. Ref.4 | |||||||||||||
| Sequence conflict | 393 | 1 | V → I in AAH69511. Ref.4 | |||||||||||||
| Sequence conflict | 651 | 1 | A → V in AAH69511. Ref.4 | |||||||||||||
Secondary structure | ||||||||||||||||
Helix Strand Turn | ||||||||||||||||
| Helix | 25 – 30 | 6 | ||||||||||||||
| Helix | 35 – 45 | 11 | ||||||||||||||
| Helix | 50 – 60 | 11 | ||||||||||||||
| Beta strand | 61 – 63 | 3 | ||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Isolation and characterization of the UBASH3A gene on 21q22.3 encoding a potential nuclear protein with a novel combination of domains." Wattenhofer M., Shibuya K., Kudoh J., Lyle R., Michaud J., Rossier C., Kawasaki K., Asakawa S., Minoshima S., Berry A., Bonne-Tamir B., Shimizu N., Antonarakis S.E., Scott H.S. Hum. Genet. 108:140-147(2001) [PubMed: 11281453] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY. Tissue: Placenta. |
| [2] | "TULA: an SH3- and UBA-containing protein that binds to c-Cbl and ubiquitin." Feshchenko E.A., Smirnova E.V., Swaminathan G., Teckchandani A.M., Agrawal R., Band H., Zhang X., Annan R.S., Carr S.A., Tsygankov A.Y. Oncogene 23:4690-4706(2004) [PubMed: 15107835] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), MASS SPECTROMETRY, INTERACTION WITH CBL AND UBIQUITIN, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. Tissue: Leukemia. |
| [3] | "The DNA sequence of human chromosome 21." Hattori M., Fujiyama A., Taylor T.D., Watanabe H., Yada T., Park H.-S., Toyoda A., Ishii K., Totoki Y., Choi D.-K., Groner Y., Soeda E., Ohki M., Takagi T., Sakaki Y., Taudien S., Blechschmidt K., Polley A. Yaspo M.-L.Nature 405:311-319(2000) [PubMed: 10830953] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANTS GLY-18 AND PHE-28. |
| [5] | "Suppressors of T-cell receptor signaling Sts-1 and Sts-2 bind to Cbl and inhibit endocytosis of receptor tyrosine kinases." Kowanetz K., Crosetto N., Haglund K., Schmidt M.H., Heldin C.-H., Dikic I. J. Biol. Chem. 279:32786-32795(2004) [PubMed: 15159412] [Abstract] Cited for: FUNCTION, MUTAGENESIS OF TRP-317, SUBUNIT, INTERACTION WITH CBL AND UBIQUITIN, IDENTIFICATION IN A COMPLEX WITH EGFR, SUBCELLULAR LOCATION. |
| [6] | "The Cbl-interacting protein TULA inhibits dynamin-dependent endocytosis." Bertelsen V., Breen K., Sandvig K., Stang E., Madshus I.H. Exp. Cell Res. 313:1696-1709(2007) [PubMed: 17382318] [Abstract] Cited for: FUNCTION, INTERACTION WITH DYNAMIN, MUTAGENESIS OF TRP-317. |
| [7] | "TULA proteins regulate activity of the protein tyrosine kinase Syk." Agrawal R., Carpino N., Tsygankov A. J. Cell. Biochem. 104:953-964(2008) [PubMed: 18189269] [Abstract] Cited for: FUNCTION, LACK OF PROTEIN PHOSPHATASE ACTIVITY. |
| [8] | "Solution structure of the UBA domain of human UBASH3A protein." RIKEN structural genomics initiative (RSGI) Submitted (NOV-2005) to the PDB data bank Cited for: STRUCTURE BY NMR OF 20-70. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AJ277750 mRNA. Translation: CAB91543.1. AF520809 mRNA. Translation: AAP80731.1. AF521702 mRNA. Translation: AAP80738.1. AP001746 Genomic DNA. No translation available. BC069357 mRNA. Translation: AAH69357.1. BC069483 mRNA. Translation: AAH69483.1. BC069511 mRNA. Translation: AAH69511.1. | ||||||||||||
| IPI | IPI00025707. IPI00215661. | ||||||||||||
| RefSeq | NP_001001895.1. NM_001001895.2. NP_001230396.1. NM_001243467.1. NP_061834.1. NM_018961.3. | ||||||||||||
| UniGene | Hs.473912. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | P57075. | ||||||||||||
| SMR | P57075. Positions 24-70, 269-350, 395-659. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | P57075. 1 interaction. | ||||||||||||
| MINT | MINT-5208648. | ||||||||||||
| STRING | P57075. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | P57075. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 10720330. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | P57075. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000319294; ENSP00000317327; ENSG00000160185. | ||||||||||||
| GeneID | 53347. | ||||||||||||
| KEGG | hsa:53347. | ||||||||||||
| UCSC | uc002zbe.1. human. uc002zbf.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 53347. | ||||||||||||
| GeneCards | GC21P043824. | ||||||||||||
| H-InvDB | HIX0016140. | ||||||||||||
| HGNC | HGNC:12462. UBASH3A. | ||||||||||||
| MIM | 605736. gene. | ||||||||||||
| neXtProt | NX_P57075. | ||||||||||||
| PharmGKB | PA37112. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| GeneTree | ENSGT00390000018249. | ||||||||||||
| HOGENOM | HBG402867. | ||||||||||||
| HOVERGEN | HBG018025. | ||||||||||||
| InParanoid | P57075. | ||||||||||||
| OMA | VIREFAM. | ||||||||||||
| PhylomeDB | P57075. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | P57075. | ||||||||||||
| Bgee | P57075. | ||||||||||||
| CleanEx | HS_UBASH3A. | ||||||||||||
| Genevestigator | P57075. | ||||||||||||
| GermOnline | ENSG00000160185. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR013078. His_Pase_superF_clade-1. IPR001452. SH3_domain. IPR009060. UBA-like. IPR015940. UBA/transl_elong_EF1B_N_euk. [Graphical view] | ||||||||||||
| Pfam | PF00300. His_Phos_1. 1 hit. PF00018. SH3_1. 1 hit. [Graphical view] | ||||||||||||
| SMART | SM00326. SH3. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF50044. SH3. 1 hit. SSF46934. UBA_like. 1 hit. | ||||||||||||
| PROSITE | PS50002. SH3. 1 hit. PS50030. UBA. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| NextBio | 55998. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | UBS3A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P57075 Secondary accession number(s): Q6HA34 Q6ISS9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 21 Human chromosome 21: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with