Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Breast cancer anti-estrogen resistance protein 1

Gene

BCAR1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Docking protein which plays a central coordinating role for tyrosine kinase-based signaling related to cell adhesion. Implicated in induction of cell migration. Overexpression confers antiestrogen resistance on breast cancer cells.2 Publications

GO - Molecular functioni

  • protein kinase binding Source: UniProtKB
  • signal transducer activity Source: ProtInc

GO - Biological processi

  • actin filament organization Source: UniProtKB
  • antigen receptor-mediated signaling pathway Source: UniProtKB
  • B cell receptor signaling pathway Source: UniProtKB
  • cell adhesion Source: UniProtKB-KW
  • cell chemotaxis Source: BHF-UCL
  • cell division Source: UniProtKB
  • cell migration Source: UniProtKB
  • cell proliferation Source: ProtInc
  • cellular response to hepatocyte growth factor stimulus Source: BHF-UCL
  • epidermal growth factor receptor signaling pathway Source: UniProtKB
  • G-protein coupled receptor signaling pathway Source: UniProtKB
  • hepatocyte growth factor receptor signaling pathway Source: BHF-UCL
  • insulin receptor signaling pathway Source: UniProtKB
  • integrin-mediated signaling pathway Source: UniProtKB
  • neurotrophin TRK receptor signaling pathway Source: UniProtKB
  • platelet-derived growth factor receptor signaling pathway Source: UniProtKB
  • positive regulation of cell migration Source: UniProtKB
  • positive regulation of endothelial cell migration Source: BHF-UCL
  • regulation of apoptotic process Source: UniProtKB
  • regulation of cell growth Source: UniProtKB
  • T cell receptor signaling pathway Source: UniProtKB
  • vascular endothelial growth factor receptor signaling pathway Source: BHF-UCL
Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Enzyme and pathway databases

BioCyciZFISH:ENSG00000050820-MONOMER.
ReactomeiR-HSA-186763. Downstream signal transduction.
R-HSA-372708. p130Cas linkage to MAPK signaling for integrins.
R-HSA-4420097. VEGFA-VEGFR2 Pathway.
R-HSA-8849471. PTK6 Regulates RHO GTPases, RAS GTPase and MAP kinases.
SignaLinkiP56945.
SIGNORiP56945.

Names & Taxonomyi

Protein namesi
Recommended name:
Breast cancer anti-estrogen resistance protein 1
Alternative name(s):
CRK-associated substrate
Cas scaffolding protein family member 1
p130cas
Gene namesi
Name:BCAR1
Synonyms:CAS, CASS1, CRKAS
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

HGNCiHGNC:971. BCAR1.

Subcellular locationi

GO - Cellular componenti

  • actin cytoskeleton Source: Ensembl
  • cytoplasm Source: UniProtKB
  • cytosol Source: Reactome
  • focal adhesion Source: UniProtKB
  • lamellipodium Source: Ensembl
  • nucleolus Source: HPA
  • plasma membrane Source: HPA
  • ruffle Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi9564.
OpenTargetsiENSG00000050820.
PharmGKBiPA25281.

Polymorphism and mutation databases

BioMutaiBCAR1.
DMDMi288558806.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000648541 – 870Breast cancer anti-estrogen resistance protein 1Add BLAST870

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionine1 Publication1
Modified residuei128Phosphotyrosine; by SRC1 Publication1
Modified residuei134PhosphoserineCombined sources1
Modified residuei139PhosphoserineCombined sources1 Publication1
Modified residuei234PhosphotyrosineBy similarity1
Modified residuei249Phosphotyrosine; by ABL1By similarity1
Modified residuei269PhosphothreonineCombined sources1
Modified residuei292PhosphoserineCombined sources1
Modified residuei362PhosphotyrosineBy similarity1
Modified residuei372PhosphotyrosineBy similarity1
Modified residuei410PhosphotyrosineBy similarity1
Modified residuei428PhosphoserineCombined sources1
Modified residuei437Phosphoserine1 Publication1
Modified residuei639PhosphoserineCombined sources1 Publication1

Post-translational modificationi

PTK2/FAK1 activation mediates phosphorylation at the YDYVHL motif; phosphorylation is most likely catalyzed by SRC family members. SRC-family kinases are recruited to the phosphorylated sites and can phosphorylate other tyrosine residues. Tyrosine phosphorylation is triggered by integrin-mediated adhesion of cells to the extracellular matrix.4 Publications
Dephosphorylated by PTPN14 at Tyr-128.

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiP56945.
MaxQBiP56945.
PaxDbiP56945.
PeptideAtlasiP56945.
PRIDEiP56945.

PTM databases

iPTMnetiP56945.
PhosphoSitePlusiP56945.

Expressioni

Tissue specificityi

Widely expressed with an abundant expression in the testis. Low level of expression seen in the liver, thymus, and peripheral blood leukocytes. The protein has been detected in a B-cell line.

Gene expression databases

BgeeiENSG00000050820.
CleanExiHS_BCAR1.
ExpressionAtlasiP56945. baseline and differential.
GenevisibleiP56945. HS.

Organism-specific databases

HPAiCAB000443.
HPA042282.

Interactioni

Subunit structurei

Forms complexes in vivo with PTK2/FAK1, adapter protein CRKL and LYN kinase. Can heterodimerize with NEDD9. Interacts with BCAR3, the interaction regulates adhesion-dependent serine phosphorylation. Interacts with NPHP1 and SH2D3C. Interacts with activated CSPG4. Interacts with BMX, INPPL1/SHIP2 and PEAK1. Part of a collagen-stimulated complex involved in cell migration made of CDC42, CRK, TNK2 and BCAR1/p130cas. Interacts with TNK2 via SH3 domains. Interacts with PTK2B/PYK2.8 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
CRKP461085EBI-702093,EBI-886
FYNP062413EBI-702093,EBI-515315
INPPL1O153572EBI-702093,EBI-1384248
MMP14P502813EBI-702093,EBI-992788
PTK2Q053972EBI-702093,EBI-702142
PTPN1P180315EBI-702093,EBI-968788
PTPN12Q052094EBI-702093,EBI-2266035
SRCP129313EBI-702093,EBI-621482
SRCIN1Q9C0H93EBI-702093,EBI-1393949
Srcin1Q9QWI63EBI-702093,EBI-775592From a different organism.
TNK2Q079125EBI-702093,EBI-603457
TNSQ042052EBI-702093,EBI-2607590From a different organism.
TNS3Q68CZ28EBI-702093,EBI-1220488

GO - Molecular functioni

  • protein kinase binding Source: UniProtKB

Protein-protein interaction databases

BioGridi114934. 66 interactors.
DIPiDIP-33855N.
IntActiP56945. 45 interactors.
MINTiMINT-1505539.
STRINGi9606.ENSP00000391669.

Structurei

Secondary structure

1870
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi5 – 12Combined sources8
Beta strandi29 – 34Combined sources6
Helixi37 – 39Combined sources3
Beta strandi43 – 48Combined sources6
Beta strandi51 – 56Combined sources6
Helixi57 – 59Combined sources3
Beta strandi60 – 68Combined sources9
Helixi740 – 770Combined sources31
Helixi775 – 801Combined sources27
Helixi806 – 835Combined sources30
Helixi840 – 870Combined sources31

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1WYXX-ray1.14A/B3-71[»]
3T6GX-ray2.50B/D645-870[»]
ProteinModelPortaliP56945.
SMRiP56945.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP56945.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini3 – 65SH3PROSITE-ProRule annotationAdd BLAST63

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni115 – 416Substrate for kinasesBy similarityAdd BLAST302
Regioni746 – 796Divergent helix-loop-helix motifAdd BLAST51

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi635 – 643SH3-bindingSequence analysis9

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi74 – 87Pro-richAdd BLAST14
Compositional biasi422 – 614Ser-richAdd BLAST193

Domaini

Contains a central domain (substrate domain) containing multiple potential SH2-binding sites and a C-terminal domain containing a divergent helix-loop-helix (HLH) motif. The SH2-binding sites putatively bind CRK, NCK and ABL1 SH2 domains. The HLH motif is absolutely required for the induction of pseudohyphal growth in yeast and mediates heterodimerization with NEDD9 (By similarity).By similarity
A serine-rich region promotes activation of the serum response element (SRE).
The SH3 domain is necessary for the localization of the protein to focal adhesions and interacts with one proline-rich region of PTK2/FAK11.

Sequence similaritiesi

Belongs to the CAS family.Curated
Contains 1 SH3 domain.PROSITE-ProRule annotation

Keywords - Domaini

SH3 domain, SH3-binding

Phylogenomic databases

eggNOGiENOG410IEDD. Eukaryota.
ENOG410ZSUM. LUCA.
GeneTreeiENSGT00490000043324.
HOGENOMiHOG000261698.
HOVERGENiHBG004354.
InParanoidiP56945.
KOiK05726.
OMAiAKAKPFD.
OrthoDBiEOG091G0RVA.
PhylomeDBiP56945.
TreeFamiTF328782.

Family and domain databases

InterProiIPR028848. BCAR1.
IPR021901. CAS_DUF3513.
IPR014928. Serine_rich.
IPR001452. SH3_domain.
IPR013315. Spectrin_alpha_SH3.
[Graphical view]
PANTHERiPTHR10654:SF15. PTHR10654:SF15. 2 hits.
PfamiPF12026. DUF3513. 1 hit.
PF08824. Serine_rich. 1 hit.
PF00018. SH3_1. 1 hit.
[Graphical view]
PRINTSiPR00452. SH3DOMAIN.
PR01887. SPECTRNALPHA.
SMARTiSM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 1 hit.
PROSITEiPS50002. SH3. 1 hit.
[Graphical view]

Sequences (8)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P56945-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNHLNVLAKA LYDNVAESPD ELSFRKGDIM TVLEQDTQGL DGWWLCSLHG
60 70 80 90 100
RQGIVPGNRL KILVGMYDKK PAGPGPGPPA TPAQPQPGLH APAPPASQYT
110 120 130 140 150
PMLPNTYQPQ PDSVYLVPTP SKAQQGLYQV PGPSPQFQSP PAKQTSTFSK
160 170 180 190 200
QTPHHPFPSP ATDLYQVPPG PGGPAQDIYQ VPPSAGMGHD IYQVPPSMDT
210 220 230 240 250
RSWEGTKPPA KVVVPTRVGQ GYVYEAAQPE QDEYDIPRHL LAPGPQDIYD
260 270 280 290 300
VPPVRGLLPS QYGQEVYDTP PMAVKGPNGR DPLLEVYDVP PSVEKGLPPS
310 320 330 340 350
NHHAVYDVPP SVSKDVPDGP LLREETYDVP PAFAKAKPFD PARTPLVLAA
360 370 380 390 400
PPPDSPPAED VYDVPPPAPD LYDVPPGLRR PGPGTLYDVP RERVLPPEVA
410 420 430 440 450
DGGVVDSGVY AVPPPAEREA PAEGKRLSAS STGSTRSSQS ASSLEVAGPG
460 470 480 490 500
REPLELEVAV EALARLQQGV SATVAHLLDL AGSAGATGSW RSPSEPQEPL
510 520 530 540 550
VQDLQAAVAA VQSAVHELLE FARSAVGNAA HTSDRALHAK LSRQLQKMED
560 570 580 590 600
VHQTLVAHGQ ALDAGRGGSG ATLEDLDRLV ACSRAVPEDA KQLASFLHGN
610 620 630 640 650
ASLLFRRTKA TAPGPEGGGT LHPNPTDKTS SIQSRPLPSP PKFTSQDSPD
660 670 680 690 700
GQYENSEGGW MEDYDYVHLQ GKEEFEKTQK ELLEKGSITR QGKSQLELQQ
710 720 730 740 750
LKQFERLEQE VSRPIDHDLA NWTPAQPLAP GRTGGLGPSD RQLLLFYLEQ
760 770 780 790 800
CEANLTTLTN AVDAFFTAVA TNQPPKIFVA HSKFVILSAH KLVFIGDTLS
810 820 830 840 850
RQAKAADVRS QVTHYSNLLC DLLRGIVATT KAAALQYPSP SAAQDMVERV
860 870
KELGHSTQQF RRVLGQLAAA
Length:870
Mass (Da):93,372
Last modified:February 9, 2010 - v2
Checksum:iB81EC3430049E795
GO
Isoform 2 (identifier: P56945-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-4: MNHL → MLTHRPQEAEQRGRTPGPSFEW

Note: No experimental confirmation available.
Show »
Length:888
Mass (Da):95,469
Checksum:i4CA6EC5C8EFE3DA6
GO
Isoform 3 (identifier: P56945-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     304-304: A → AVSKCQGNARARLRLWGVW

Show »
Length:888
Mass (Da):95,454
Checksum:iFF81642D11EB93AC
GO
Isoform 4 (identifier: P56945-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-4: MNHL → MQGK
     64-211: Missing.

Note: No experimental confirmation available.
Show »
Length:722
Mass (Da):77,731
Checksum:i2537ED6C3BEBE512
GO
Isoform 5 (identifier: P56945-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-4: MNHL → ME

Note: No experimental confirmation available.
Show »
Length:868
Mass (Da):93,137
Checksum:iDB6B70B2AB1926CD
GO
Isoform 6 (identifier: P56945-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-4: MNHL → MPAKPFLSSVLLSWKVLDFSGPGPQGTGQPCSCGHWAEGQGGPPEPAGGP

Note: No experimental confirmation available.
Show »
Length:916
Mass (Da):97,877
Checksum:i3A5FDEB4BA15527B
GO
Isoform 7 (identifier: P56945-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-4: MNHL → MHCPGEAPLAAPRPTPKDPCLR

Note: No experimental confirmation available.
Show »
Length:888
Mass (Da):95,216
Checksum:iCD3BA8494536FC76
GO
Isoform 8 (identifier: P56945-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-4: MNHL → MSVP

Note: No experimental confirmation available.
Show »
Length:870
Mass (Da):93,291
Checksum:i2262F3718326A675
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti63L → S in BAB55230 (PubMed:14702039).Curated1
Sequence conflicti236I → T in AAF27527 (Ref. 2) Curated1
Sequence conflicti254V → I in BAG54099 (PubMed:14702039).Curated1
Sequence conflicti349A → G in AAF27527 (Ref. 2) Curated1
Sequence conflicti363D → Y in AAF27527 (Ref. 2) Curated1
Sequence conflicti385T → A in AAS48631 (Ref. 4) Curated1
Sequence conflicti428S → P in BAB55230 (PubMed:14702039).Curated1
Sequence conflicti471S → G in BAB55230 (PubMed:14702039).Curated1
Sequence conflicti600N → S in AAS48631 (Ref. 4) Curated1
Sequence conflicti700Q → R in BAH13763 (PubMed:14702039).Curated1
Sequence conflicti714P → L in BAG54099 (PubMed:14702039).Curated1
Sequence conflicti740D → G in AAS48631 (Ref. 4) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05897076P → S.4 PublicationsCorresponds to variant rs1035539dbSNPEnsembl.1
Natural variantiVAR_035798407S → T in a breast cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_057820491R → L.Corresponds to variant rs16957558dbSNPEnsembl.1
Natural variantiVAR_057821558H → R.Corresponds to variant rs16957552dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0435591 – 4MNHL → MLTHRPQEAEQRGRTPGPSF EW in isoform 2. 1 Publication4
Alternative sequenceiVSP_0461271 – 4MNHL → MQGK in isoform 4. 1 Publication4
Alternative sequenceiVSP_0467481 – 4MNHL → ME in isoform 5. 1 Publication4
Alternative sequenceiVSP_0467491 – 4MNHL → MPAKPFLSSVLLSWKVLDFS GPGPQGTGQPCSCGHWAEGQ GGPPEPAGGP in isoform 6. 1 Publication4
Alternative sequenceiVSP_0467501 – 4MNHL → MHCPGEAPLAAPRPTPKDPC LR in isoform 7. 1 Publication4
Alternative sequenceiVSP_0467511 – 4MNHL → MSVP in isoform 8. 1 Publication4
Alternative sequenceiVSP_04612864 – 211Missing in isoform 4. 1 PublicationAdd BLAST148
Alternative sequenceiVSP_045355304A → AVSKCQGNARARLRLWGVW in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ242987 mRNA. Translation: CAB75875.2.
AF218451 mRNA. Translation: AAF27527.1.
AB040024 mRNA. Translation: BAA92711.1.
AY545071 mRNA. Translation: AAS48631.1.
AK027608 mRNA. Translation: BAB55230.1.
AK124815 mRNA. Translation: BAG54099.1.
AK293808 mRNA. Translation: BAG57215.1.
AK294513 mRNA. Translation: BAG57726.1.
AK295809 mRNA. Translation: BAG58627.1.
AK302617 mRNA. Translation: BAH13763.1.
AC009078 Genomic DNA. No translation available.
CCDSiCCDS10915.1. [P56945-1]
CCDS54037.1. [P56945-5]
CCDS54038.1. [P56945-3]
CCDS54039.1. [P56945-4]
CCDS54040.1. [P56945-6]
CCDS54041.1. [P56945-8]
CCDS54042.1. [P56945-2]
CCDS54043.1. [P56945-7]
RefSeqiNP_001164185.1. NM_001170714.1. [P56945-6]
NP_001164186.1. NM_001170715.1. [P56945-7]
NP_001164187.1. NM_001170716.1. [P56945-2]
NP_001164188.1. NM_001170717.1. [P56945-3]
NP_001164189.1. NM_001170718.1. [P56945-8]
NP_001164190.1. NM_001170719.1. [P56945-5]
NP_001164191.1. NM_001170720.1. [P56945-4]
NP_001164192.1. NM_001170721.1.
NP_055382.2. NM_014567.3. [P56945-1]
XP_016879386.1. XM_017023897.1. [P56945-6]
UniGeneiHs.479747.

Genome annotation databases

EnsembliENST00000162330; ENSP00000162330; ENSG00000050820. [P56945-1]
ENST00000393420; ENSP00000377072; ENSG00000050820. [P56945-3]
ENST00000393422; ENSP00000377074; ENSG00000050820. [P56945-7]
ENST00000418647; ENSP00000391669; ENSG00000050820. [P56945-6]
ENST00000420641; ENSP00000392708; ENSG00000050820. [P56945-2]
ENST00000535626; ENSP00000440370; ENSG00000050820. [P56945-4]
ENST00000538440; ENSP00000443841; ENSG00000050820. [P56945-8]
ENST00000542031; ENSP00000440415; ENSG00000050820. [P56945-5]
GeneIDi9564.
KEGGihsa:9564.
UCSCiuc002fdv.4. human. [P56945-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ242987 mRNA. Translation: CAB75875.2.
AF218451 mRNA. Translation: AAF27527.1.
AB040024 mRNA. Translation: BAA92711.1.
AY545071 mRNA. Translation: AAS48631.1.
AK027608 mRNA. Translation: BAB55230.1.
AK124815 mRNA. Translation: BAG54099.1.
AK293808 mRNA. Translation: BAG57215.1.
AK294513 mRNA. Translation: BAG57726.1.
AK295809 mRNA. Translation: BAG58627.1.
AK302617 mRNA. Translation: BAH13763.1.
AC009078 Genomic DNA. No translation available.
CCDSiCCDS10915.1. [P56945-1]
CCDS54037.1. [P56945-5]
CCDS54038.1. [P56945-3]
CCDS54039.1. [P56945-4]
CCDS54040.1. [P56945-6]
CCDS54041.1. [P56945-8]
CCDS54042.1. [P56945-2]
CCDS54043.1. [P56945-7]
RefSeqiNP_001164185.1. NM_001170714.1. [P56945-6]
NP_001164186.1. NM_001170715.1. [P56945-7]
NP_001164187.1. NM_001170716.1. [P56945-2]
NP_001164188.1. NM_001170717.1. [P56945-3]
NP_001164189.1. NM_001170718.1. [P56945-8]
NP_001164190.1. NM_001170719.1. [P56945-5]
NP_001164191.1. NM_001170720.1. [P56945-4]
NP_001164192.1. NM_001170721.1.
NP_055382.2. NM_014567.3. [P56945-1]
XP_016879386.1. XM_017023897.1. [P56945-6]
UniGeneiHs.479747.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1WYXX-ray1.14A/B3-71[»]
3T6GX-ray2.50B/D645-870[»]
ProteinModelPortaliP56945.
SMRiP56945.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114934. 66 interactors.
DIPiDIP-33855N.
IntActiP56945. 45 interactors.
MINTiMINT-1505539.
STRINGi9606.ENSP00000391669.

PTM databases

iPTMnetiP56945.
PhosphoSitePlusiP56945.

Polymorphism and mutation databases

BioMutaiBCAR1.
DMDMi288558806.

Proteomic databases

EPDiP56945.
MaxQBiP56945.
PaxDbiP56945.
PeptideAtlasiP56945.
PRIDEiP56945.

Protocols and materials databases

DNASUi9564.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000162330; ENSP00000162330; ENSG00000050820. [P56945-1]
ENST00000393420; ENSP00000377072; ENSG00000050820. [P56945-3]
ENST00000393422; ENSP00000377074; ENSG00000050820. [P56945-7]
ENST00000418647; ENSP00000391669; ENSG00000050820. [P56945-6]
ENST00000420641; ENSP00000392708; ENSG00000050820. [P56945-2]
ENST00000535626; ENSP00000440370; ENSG00000050820. [P56945-4]
ENST00000538440; ENSP00000443841; ENSG00000050820. [P56945-8]
ENST00000542031; ENSP00000440415; ENSG00000050820. [P56945-5]
GeneIDi9564.
KEGGihsa:9564.
UCSCiuc002fdv.4. human. [P56945-1]

Organism-specific databases

CTDi9564.
DisGeNETi9564.
GeneCardsiBCAR1.
H-InvDBHIX0173293.
HGNCiHGNC:971. BCAR1.
HPAiCAB000443.
HPA042282.
MIMi602941. gene.
neXtProtiNX_P56945.
OpenTargetsiENSG00000050820.
PharmGKBiPA25281.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IEDD. Eukaryota.
ENOG410ZSUM. LUCA.
GeneTreeiENSGT00490000043324.
HOGENOMiHOG000261698.
HOVERGENiHBG004354.
InParanoidiP56945.
KOiK05726.
OMAiAKAKPFD.
OrthoDBiEOG091G0RVA.
PhylomeDBiP56945.
TreeFamiTF328782.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000050820-MONOMER.
ReactomeiR-HSA-186763. Downstream signal transduction.
R-HSA-372708. p130Cas linkage to MAPK signaling for integrins.
R-HSA-4420097. VEGFA-VEGFR2 Pathway.
R-HSA-8849471. PTK6 Regulates RHO GTPases, RAS GTPase and MAP kinases.
SignaLinkiP56945.
SIGNORiP56945.

Miscellaneous databases

ChiTaRSiBCAR1. human.
EvolutionaryTraceiP56945.
GeneWikiiBCAR1.
GenomeRNAii9564.
PROiP56945.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000050820.
CleanExiHS_BCAR1.
ExpressionAtlasiP56945. baseline and differential.
GenevisibleiP56945. HS.

Family and domain databases

InterProiIPR028848. BCAR1.
IPR021901. CAS_DUF3513.
IPR014928. Serine_rich.
IPR001452. SH3_domain.
IPR013315. Spectrin_alpha_SH3.
[Graphical view]
PANTHERiPTHR10654:SF15. PTHR10654:SF15. 2 hits.
PfamiPF12026. DUF3513. 1 hit.
PF08824. Serine_rich. 1 hit.
PF00018. SH3_1. 1 hit.
[Graphical view]
PRINTSiPR00452. SH3DOMAIN.
PR01887. SPECTRNALPHA.
SMARTiSM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 1 hit.
PROSITEiPS50002. SH3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiBCAR1_HUMAN
AccessioniPrimary (citable) accession number: P56945
Secondary accession number(s): B3KWD7
, B4DEV4, B4DGB5, B4DIW5, B7Z7X7, E9PCL5, E9PCV2, F5GXA2, F5GXV6, F5H7Z0, F8WA69, Q6QEF7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: February 9, 2010
Last modified: November 30, 2016
This is version 169 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.