SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P56704

- WNT3A_HUMAN

UniProt

P56704 - WNT3A_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Protein Wnt-3a

Gene
WNT3A
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Ligand for members of the frizzled family of seven transmembrane receptors. Wnt-3 and Wnt-3a play distinct roles in cell-cell signaling during morphogenesis of the developing neural tube.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei26 – 272Cleavage; by TIKI1 and TIKI2 By similarity

GO - Molecular functioni

  1. frizzled binding Source: RefGenome
  2. protein binding Source: UniProtKB
  3. receptor agonist activity Source: BHF-UCL
  4. transcription coactivator activity Source: BHF-UCL

GO - Biological processi

  1. axis elongation involved in somitogenesis Source: Ensembl
  2. axon guidance Source: Ensembl
  3. canonical Wnt signaling pathway Source: BHF-UCL
  4. canonical Wnt signaling pathway involved in cardiac muscle cell fate commitment Source: BHF-UCL
  5. cell proliferation in forebrain Source: BHF-UCL
  6. cellular protein localization Source: Ensembl
  7. cellular response to retinoic acid Source: UniProtKB
  8. COP9 signalosome assembly Source: BHF-UCL
  9. dorsal/ventral neural tube patterning Source: Ensembl
  10. extracellular matrix organization Source: Ensembl
  11. heart looping Source: Ensembl
  12. hemopoiesis Source: Ensembl
  13. hippocampus development Source: Ensembl
  14. inner ear morphogenesis Source: Ensembl
  15. in utero embryonic development Source: Ensembl
  16. mammary gland development Source: Ensembl
  17. negative regulation of axon extension involved in axon guidance Source: Ensembl
  18. negative regulation of fat cell differentiation Source: Ensembl
  19. negative regulation of heart induction by canonical Wnt signaling pathway Source: BHF-UCL
  20. negative regulation of neurogenesis Source: BHF-UCL
  21. negative regulation of neuron projection development Source: UniProtKB
  22. neuron differentiation Source: UniProtKB
  23. osteoblast differentiation Source: Ensembl
  24. palate development Source: BHF-UCL
  25. paraxial mesodermal cell fate commitment Source: Ensembl
  26. platelet aggregation Source: Ensembl
  27. positive regulation of B cell proliferation Source: Ensembl
  28. positive regulation of canonical Wnt signaling pathway Source: UniProtKB
  29. positive regulation of canonical Wnt signaling pathway involved in controlling type B pancreatic cell proliferation Source: Ensembl
  30. positive regulation of cardiac muscle cell differentiation Source: BHF-UCL
  31. positive regulation of catenin import into nucleus Source: BHF-UCL
  32. positive regulation of cell-cell adhesion mediated by cadherin Source: Ensembl
  33. positive regulation of cell proliferation Source: BHF-UCL
  34. positive regulation of collateral sprouting in absence of injury Source: Ensembl
  35. positive regulation of cysteine-type endopeptidase activity involved in apoptotic process Source: Ensembl
  36. positive regulation of dermatome development Source: BHF-UCL
  37. positive regulation of mesodermal cell fate specification Source: BHF-UCL
  38. positive regulation of peptidyl-serine phosphorylation Source: BHF-UCL
  39. positive regulation of protein binding Source: BHF-UCL
  40. positive regulation of protein phosphorylation Source: BHF-UCL
  41. positive regulation of protein tyrosine kinase activity Source: Ensembl
  42. positive regulation of receptor internalization Source: BHF-UCL
  43. positive regulation of sequence-specific DNA binding transcription factor activity Source: Ensembl
  44. positive regulation of transcription, DNA-templated Source: BHF-UCL
  45. positive regulation of transcription from RNA polymerase II promoter Source: BHF-UCL
  46. post-anal tail morphogenesis Source: Ensembl
  47. regulation of microtubule cytoskeleton organization Source: Ensembl
  48. skeletal muscle cell differentiation Source: Ensembl
  49. spinal cord association neuron differentiation Source: Ensembl
  50. Wnt signaling pathway involved in forebrain neuroblast division Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Wnt signaling pathway

Enzyme and pathway databases

ReactomeiREACT_163710. WNT ligand biogenesis and trafficking.
REACT_18372. Class B/2 (Secretin family receptors).
REACT_200610. disassembly of the destruction complex and recruitment of AXIN to the membrane.
REACT_200643. negative regulation of TCF-dependent signaling by WNT ligand antagonists.
REACT_200716. regulation of FZD by ubiquitination.
REACT_200777. TCF dependent signaling in response to WNT.
SignaLinkiP56704.

Names & Taxonomyi

Protein namesi
Recommended name:
Protein Wnt-3a
Gene namesi
Name:WNT3A
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:15983. WNT3A.

Subcellular locationi

GO - Cellular componenti

  1. cell surface Source: BHF-UCL
  2. endoplasmic reticulum lumen Source: Reactome
  3. extracellular region Source: Reactome
  4. extracellular space Source: BHF-UCL
  5. Golgi lumen Source: Reactome
  6. plasma membrane Source: Reactome
  7. proteinaceous extracellular matrix Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Extracellular matrix, Secreted

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi87 – 871N → Q: Strongly reduced ability to stimulate Wnt-responsive reporters; when associated with Q-298.
Mutagenesisi209 – 2091S → A: Abrogates WLS binding. 1 Publication
Mutagenesisi209 – 2091S → A: Complete loss of palmitoylation.
Mutagenesisi209 – 2091S → T: No effect on palmitoylation and secretion; the threonine can functionally replace the serine.
Mutagenesisi298 – 2981N → Q: Strongly reduced ability to stimulate Wnt-responsive reporters; when associated with Q-87.
Mutagenesisi334 – 3341C → A: No signaling activity despite the presence of significant amounts of secreted monomeric Wnt3a exhibit dominant negative properties; when associated with A-335.
Mutagenesisi335 – 3351C → A: No signaling activity despite the presence of significant amounts of secreted monomeric Wnt3a, exhibit dominant negative properties; when associated with A-334.

Organism-specific databases

Orphaneti85193. Idiopathic juvenile osteoporosis.
PharmGKBiPA38074.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1818 Reviewed predictionAdd
BLAST
Chaini19 – 352334Protein Wnt-3aPRO_0000041418Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi77 ↔ 88 By similarity
Glycosylationi87 – 871N-linked (GlcNAc...)
Disulfide bondi128 ↔ 136 By similarity
Disulfide bondi138 ↔ 155 By similarity
Disulfide bondi203 ↔ 217 By similarity
Disulfide bondi205 ↔ 212 By similarity
Lipidationi209 – 2091O-palmitoyl serine; by PORCN2 Publications
Disulfide bondi297 ↔ 312 By similarity
Glycosylationi298 – 2981N-linked (GlcNAc...)
Disulfide bondi327 ↔ 342 By similarity
Disulfide bondi329 ↔ 339 By similarity
Disulfide bondi334 ↔ 335 By similarity

Post-translational modificationi

Palmitoylation at Ser-209 by PORCN is required for efficient binding to frizzled receptors. Palmitoylation is required for proper trafficking to cell surface, vacuolar acidification is critical to release palmitoylated WNT3A from WLS in secretory vesicles. A palmitoylation site was proposed at Cys-77, but it was later shown that this cysteine is engaged in a disulfide bond.
Proteolytic processing by TIKI1 and TIKI2 promotes oxidation and formation of large disulfide-bond oligomers, leading to inactivation of WNT3A.
Disulfide bonds have critical and distinct roles in secretion and activity. Loss of each conserved cysteine in WNT3A results in high molecular weight oxidized Wnt oligomers, which are formed through inter-Wnt disulfide bonding.

Keywords - PTMi

Disulfide bond, Glycoprotein, Lipoprotein, Palmitate

Proteomic databases

PaxDbiP56704.
PRIDEiP56704.

PTM databases

PhosphoSiteiP56704.

Expressioni

Tissue specificityi

Moderately expressed in placenta and at low levels in adult lung, spleen, and prostate.

Gene expression databases

BgeeiP56704.
CleanExiHS_WNT3A.
GenevestigatoriP56704.

Organism-specific databases

HPAiHPA050514.

Interactioni

Subunit structurei

Homooligomer; disulfide-linked, leading to inactivation By similarity. Interacts with PORCN. Interacts with APCDD1 and WLS. Component of the Wnt-Fzd-LRP5-LRP6 signaling complex that contains a WNT protein, a FZD protein and LRP5 or LRP6. Interacts directly in the complex with LRP6.3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
FZD8Q9H4612EBI-6173037,EBI-6254212

Protein-protein interaction databases

BioGridi124599. 4 interactions.
DIPiDIP-58592N.
IntActiP56704. 3 interactions.
STRINGi9606.ENSP00000284523.

Structurei

3D structure databases

ProteinModelPortaliP56704.
SMRiP56704. Positions 57-351.

Family & Domainsi

Sequence similaritiesi

Belongs to the Wnt family.

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiNOG284879.
HOGENOMiHOG000039529.
HOVERGENiHBG001595.
InParanoidiP56704.
KOiK00312.
OMAiCTTVNDS.
OrthoDBiEOG7C8GJ8.
PhylomeDBiP56704.
TreeFamiTF105310.

Family and domain databases

InterProiIPR005817. Wnt.
IPR009141. Wnt3.
IPR018161. Wnt_CS.
[Graphical view]
PANTHERiPTHR12027. PTHR12027. 1 hit.
PfamiPF00110. wnt. 1 hit.
[Graphical view]
PRINTSiPR01843. WNT3PROTEIN.
PR01349. WNTPROTEIN.
SMARTiSM00097. WNT1. 1 hit.
[Graphical view]
PROSITEiPS00246. WNT1. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P56704-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAPLGYFLLL CSLKQALGSY PIWWSLAVGP QYSSLGSQPI LCASIPGLVP    50
KQLRFCRNYV EIMPSVAEGI KIGIQECQHQ FRGRRWNCTT VHDSLAIFGP 100
VLDKATRESA FVHAIASAGV AFAVTRSCAE GTAAICGCSS RHQGSPGKGW 150
KWGGCSEDIE FGGMVSREFA DARENRPDAR SAMNRHNNEA GRQAIASHMH 200
LKCKCHGLSG SCEVKTCWWS QPDFRAIGDF LKDKYDSASE MVVEKHRESR 250
GWVETLRPRY TYFKVPTERD LVYYEASPNF CEPNPETGSF GTRDRTCNVS 300
SHGIDGCDLL CCGRGHNARA ERRREKCRCV FHWCCYVSCQ ECTRVYDVHT 350
CK 352
Length:352
Mass (Da):39,365
Last modified:May 10, 2002 - v2
Checksum:iA317BD6D4A73920B
GO
Isoform 2 (identifier: P56704-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     352-352: K → KNPGSRAGNSAHQPPHPQPPVRFHPPLRRAGKVP

Show »
Length:385
Mass (Da):42,905
Checksum:iB2BBBFD1C7CA7E56
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei352 – 3521K → KNPGSRAGNSAHQPPHPQPP VRFHPPLRRAGKVP in isoform 2. VSP_046558

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB060284 mRNA. Translation: BAB61052.1.
AK056278 mRNA. Translation: BAB71136.1.
AL136379 Genomic DNA. Translation: CAI23122.1.
BC103921 mRNA. Translation: AAI03922.1.
BC103922 mRNA. Translation: AAI03923.1.
BC103923 mRNA. Translation: AAI03924.1.
CCDSiCCDS1564.1. [P56704-1]
RefSeqiNP_149122.1. NM_033131.3. [P56704-1]
UniGeneiHs.336930.

Genome annotation databases

EnsembliENST00000284523; ENSP00000284523; ENSG00000154342. [P56704-1]
ENST00000366753; ENSP00000355715; ENSG00000154342. [P56704-2]
GeneIDi89780.
KEGGihsa:89780.
UCSCiuc001hrp.2. human.
uc001hrq.2. human. [P56704-1]

Polymorphism databases

DMDMi20532424.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB060284 mRNA. Translation: BAB61052.1 .
AK056278 mRNA. Translation: BAB71136.1 .
AL136379 Genomic DNA. Translation: CAI23122.1 .
BC103921 mRNA. Translation: AAI03922.1 .
BC103922 mRNA. Translation: AAI03923.1 .
BC103923 mRNA. Translation: AAI03924.1 .
CCDSi CCDS1564.1. [P56704-1 ]
RefSeqi NP_149122.1. NM_033131.3. [P56704-1 ]
UniGenei Hs.336930.

3D structure databases

ProteinModelPortali P56704.
SMRi P56704. Positions 57-351.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 124599. 4 interactions.
DIPi DIP-58592N.
IntActi P56704. 3 interactions.
STRINGi 9606.ENSP00000284523.

Chemistry

BindingDBi P56704.
ChEMBLi CHEMBL1255137.

PTM databases

PhosphoSitei P56704.

Polymorphism databases

DMDMi 20532424.

Proteomic databases

PaxDbi P56704.
PRIDEi P56704.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000284523 ; ENSP00000284523 ; ENSG00000154342 . [P56704-1 ]
ENST00000366753 ; ENSP00000355715 ; ENSG00000154342 . [P56704-2 ]
GeneIDi 89780.
KEGGi hsa:89780.
UCSCi uc001hrp.2. human.
uc001hrq.2. human. [P56704-1 ]

Organism-specific databases

CTDi 89780.
GeneCardsi GC01P228194.
HGNCi HGNC:15983. WNT3A.
HPAi HPA050514.
MIMi 606359. gene.
neXtProti NX_P56704.
Orphaneti 85193. Idiopathic juvenile osteoporosis.
PharmGKBi PA38074.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG284879.
HOGENOMi HOG000039529.
HOVERGENi HBG001595.
InParanoidi P56704.
KOi K00312.
OMAi CTTVNDS.
OrthoDBi EOG7C8GJ8.
PhylomeDBi P56704.
TreeFami TF105310.

Enzyme and pathway databases

Reactomei REACT_163710. WNT ligand biogenesis and trafficking.
REACT_18372. Class B/2 (Secretin family receptors).
REACT_200610. disassembly of the destruction complex and recruitment of AXIN to the membrane.
REACT_200643. negative regulation of TCF-dependent signaling by WNT ligand antagonists.
REACT_200716. regulation of FZD by ubiquitination.
REACT_200777. TCF dependent signaling in response to WNT.
SignaLinki P56704.

Miscellaneous databases

GeneWikii WNT3A.
GenomeRNAii 89780.
NextBioi 76263.
PROi P56704.
SOURCEi Search...

Gene expression databases

Bgeei P56704.
CleanExi HS_WNT3A.
Genevestigatori P56704.

Family and domain databases

InterProi IPR005817. Wnt.
IPR009141. Wnt3.
IPR018161. Wnt_CS.
[Graphical view ]
PANTHERi PTHR12027. PTHR12027. 1 hit.
Pfami PF00110. wnt. 1 hit.
[Graphical view ]
PRINTSi PR01843. WNT3PROTEIN.
PR01349. WNTPROTEIN.
SMARTi SM00097. WNT1. 1 hit.
[Graphical view ]
PROSITEi PS00246. WNT1. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning and characterization of WNT3a and WNT14 clustered in human chromosome 1q42 region."
    Saitoh T., Hirai M., Katoh M.
    Biochem. Biophys. Res. Commun. 284:1168-1175(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  3. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
  5. "Differential expression of human Wnt genes 2, 3, 4, and 7B in human breast cell lines and normal and disease states of human breast tissue."
    Huguet E.L., McMahon J.A., McMahon A.P., Bicknell R., Harris A.L.
    Cancer Res. 54:2615-2621(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 207-330.
    Tissue: Mammary gland.
  6. "Wntless, a conserved membrane protein dedicated to the secretion of Wnt proteins from signaling cells."
    Baenziger C., Soldini D., Schuett C., Zipperlen P., Hausmann G., Basler K.
    Cell 125:509-522(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH WLS.
  7. "Reconstitution of a frizzled8.Wnt3a.LRP6 signaling complex reveals multiple Wnt and Dkk1 binding sites on LRP6."
    Bourhis E., Tam C., Franke Y., Bazan J.F., Ernst J., Hwang J., Costa M., Cochran A.G., Hannoush R.N.
    J. Biol. Chem. 285:9172-9179(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH LRP6 IN THE WNT/FZD/LRP6 COMPLEX.
  8. Cited for: PALMITOYLATION AT SER-209 BY PORCN, MUTAGENESIS OF SER-209.
  9. Cited for: INTERACTION WITH APCDD1.
  10. "Fatty acid modification of Wnt1 and Wnt3a at serine is prerequisite for lipidation at cysteine and is essential for Wnt signalling."
    Doubravska L., Krausova M., Gradl D., Vojtechova M., Tumova L., Lukas J., Valenta T., Pospichalova V., Fafilek B., Plachy J., Sebesta O., Korinek V.
    Cell. Signal. 23:837-848(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PRELIMINARY CYSTEINE PALMITOYLATION, PALMITOYLATION AT SER-209, GLYCOSYLATION AT ASN-87 AND ASN-298, MUTAGENESIS OF ASN-87; SER-209 AND ASN-298.
  11. Cited for: DISULFIDE BONDS, MUTAGENESIS OF SER-209; CYS-334 AND CYS-335.
  12. "Single-cell imaging of Wnt palmitoylation by the acyltransferase porcupine."
    Gao X., Hannoush R.N.
    Nat. Chem. Biol. 10:61-68(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: LACK OF PALMITOYLATION AT CYS-77, PALMITOYLATION AT SER-209 BY PORCN.

Entry informationi

Entry nameiWNT3A_HUMAN
AccessioniPrimary (citable) accession number: P56704
Secondary accession number(s): Q3SY79, Q3SY80, Q969P2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: May 10, 2002
Last modified: September 3, 2014
This is version 129 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi