Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

ATP synthase subunit f, mitochondrial

Gene

ATP5J2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F1 - containing the extramembraneous catalytic core and F0 - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F0 domain. Minor subunit located with subunit a in the membrane.

GO - Molecular functioni

  • transmembrane transporter activity Source: UniProtKB

GO - Biological processi

Keywordsi

Biological processATP synthesis, Hydrogen ion transport, Ion transport, Transport

Enzyme and pathway databases

ReactomeiR-HSA-163210. Formation of ATP by chemiosmotic coupling.
R-HSA-8949613. Cristae formation.

Names & Taxonomyi

Protein namesi
Recommended name:
ATP synthase subunit f, mitochondrial
Gene namesi
Name:ATP5J2
Synonyms:ATP5JL
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

EuPathDBiHostDB:ENSG00000241468.7.
HGNCiHGNC:848. ATP5J2.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei63 – 82HelicalSequence analysisAdd BLAST20

Keywords - Cellular componenti

CF(0), Membrane, Mitochondrion, Mitochondrion inner membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi9551.
OpenTargetsiENSG00000241468.
PharmGKBiPA25138.

Polymorphism and mutation databases

BioMutaiATP5J2.
DMDMi7404340.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00001948242 – 94ATP synthase subunit f, mitochondrialAdd BLAST93

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1
Modified residuei3PhosphoserineBy similarity1
Modified residuei22N6-acetyllysineBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiP56134.
PaxDbiP56134.
PeptideAtlasiP56134.
PRIDEiP56134.
TopDownProteomicsiP56134-1. [P56134-1]
P56134-2. [P56134-2]

PTM databases

iPTMnetiP56134.
PhosphoSitePlusiP56134.
SwissPalmiP56134.

Expressioni

Gene expression databases

BgeeiENSG00000241468.
CleanExiHS_ATP5J2.
ExpressionAtlasiP56134. baseline and differential.
GenevisibleiP56134. HS.

Organism-specific databases

HPAiHPA067267.
HPA070412.

Interactioni

Subunit structurei

F-type ATPases have 2 components, CF1 - the catalytic core - and CF0 - the membrane proton channel. CF0 seems to have nine subunits: a, b, c, d, e, f, g, F6 and 8 (or A6L). Component of an ATP synthase complex composed of ATP5F1, ATP5G1, ATP5E, ATP5H, ATP5I, ATP5J, ATP5J2, MT-ATP6, MT-ATP8, ATP5A1, ATP5B, ATP5D, ATP5C1, ATP5O, ATP5L, USMG5 and MP68 (By similarity).By similarity

Protein-protein interaction databases

BioGridi114923. 40 interactors.
CORUMiP56134.
IntActiP56134. 32 interactors.
MINTiMINT-1370314.
STRINGi9606.ENSP00000292475.

Structurei

3D structure databases

ProteinModelPortaliP56134.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the ATPase F chain family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG4092. Eukaryota.
ENOG4111PBN. LUCA.
GeneTreeiENSGT00510000046986.
HOGENOMiHOG000293164.
HOVERGENiHBG002418.
InParanoidiP56134.
KOiK02130.
PhylomeDBiP56134.
TreeFamiTF342865.

Family and domain databases

InterProiView protein in InterPro
IPR019344. F1F0-ATPsyn_F_prd.
PANTHERiPTHR13080. PTHR13080. 1 hit.
PfamiView protein in Pfam
PF10206. WRW. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P56134-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASVGECPAP VPVKDKKLLE VKLGELPSWI LMRDFSPSGI FGAFQRGYYR
60 70 80 90
YYNKYINVKK GSISGITMVL ACYVLFSYSF SYKHLKHERL RKYH
Length:94
Mass (Da):10,918
Last modified:January 23, 2007 - v3
Checksum:iD5F0D94273DEF880
GO
Isoform 2 (identifier: P56134-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     5-10: Missing.

Note: No experimental confirmation available.
Show »
Length:88
Mass (Da):10,363
Checksum:i38072EB09CAC8D65
GO
Isoform 3 (identifier: P56134-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     47-86: GYYRYYNKYINVKKGSISGITMVLACYVLFSYSFSYKHLK → E

Note: No experimental confirmation available. Gene prediction based on EST data.
Show »
Length:55
Mass (Da):6,295
Checksum:iC19548A6E4E7BF11
GO
Isoform 4 (identifier: P56134-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     5-10: Missing.
     47-86: GYYRYYNKYINVKKGSISGITMVLACYVLFSYSFSYKHLK → E

Note: No experimental confirmation available. Gene prediction based on EST data.
Show »
Length:49
Mass (Da):5,741
Checksum:i3B1C513E7C1FA43F
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti24G → L in AAH03678 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0004375 – 10Missing in isoform 2 and isoform 4. 1 Publication6
Alternative sequenceiVSP_04674647 – 86GYYRY…YKHLK → E in isoform 3 and isoform 4. CuratedAdd BLAST40

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF088918 mRNA. Translation: AAC34895.1.
AF047436 mRNA. Translation: AAC39887.1.
AY046911 mRNA. Translation: AAL06647.1.
CR456891 mRNA. Translation: CAG33172.1.
CR542155 mRNA. Translation: CAG46952.1.
AC073063 Genomic DNA. No translation available.
CH236956 Genomic DNA. Translation: EAL23877.1.
CH471091 Genomic DNA. Translation: EAW76661.1.
BC003678 mRNA. Translation: AAH03678.1.
CCDSiCCDS34692.1. [P56134-3]
CCDS47653.1. [P56134-4]
CCDS47654.1. [P56134-2]
CCDS5665.1. [P56134-1]
RefSeqiNP_001003713.1. NM_001003713.2. [P56134-2]
NP_001003714.1. NM_001003714.2. [P56134-3]
NP_001034267.1. NM_001039178.2. [P56134-4]
NP_004880.1. NM_004889.3. [P56134-1]
UniGeneiHs.521056.
Hs.656515.

Genome annotation databases

EnsembliENST00000292475; ENSP00000292475; ENSG00000241468. [P56134-1]
ENST00000359832; ENSP00000352890; ENSG00000241468. [P56134-3]
ENST00000394186; ENSP00000377740; ENSG00000241468. [P56134-2]
ENST00000414062; ENSP00000412149; ENSG00000241468. [P56134-4]
ENST00000488775; ENSP00000418197; ENSG00000241468. [P56134-4]
GeneIDi9551.
KEGGihsa:9551.
UCSCiuc003uql.4. human. [P56134-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiATPK_HUMAN
AccessioniPrimary (citable) accession number: P56134
Secondary accession number(s): C9J8H9
, F8W7V3, O76079, Q6IBB3, Q96L83, Q9BTI8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: January 23, 2007
Last modified: September 27, 2017
This is version 159 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families