Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P55957

- BID_HUMAN

UniProt

P55957 - BID_HUMAN

Protein

BH3-interacting domain death agonist

Gene

BID

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 148 (01 Oct 2014)
      Sequence version 1 (01 Nov 1997)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    The major proteolytic product p15 BID allows the release of cytochrome c By similarity. Isoform 1, isoform 2 and isoform 4 induce ICE-like proteases and apoptosis. Isoform 3 does not induce apoptosis. Counters the protective effect of Bcl-2.By similarity1 Publication

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sitei61 – 622CleavageBy similarity
    Sitei76 – 772CleavageBy similarity
    Sitei99 – 1002CleavageBy similarity

    GO - Molecular functioni

    1. death receptor binding Source: ProtInc
    2. protein binding Source: IntAct

    GO - Biological processi

    1. activation of cysteine-type endopeptidase activity involved in apoptotic process Source: Ensembl
    2. apoptotic mitochondrial changes Source: ProtInc
    3. apoptotic process Source: Reactome
    4. brain development Source: Ensembl
    5. establishment of protein localization to membrane Source: BHF-UCL
    6. extrinsic apoptotic signaling pathway via death domain receptors Source: ProtInc
    7. glial cell apoptotic process Source: Ensembl
    8. intrinsic apoptotic signaling pathway Source: Reactome
    9. neuron apoptotic process Source: HGNC
    10. positive regulation of apoptotic process Source: UniProtKB
    11. positive regulation of extrinsic apoptotic signaling pathway Source: UniProtKB
    12. positive regulation of intrinsic apoptotic signaling pathway Source: Reactome
    13. positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway Source: Reactome
    14. positive regulation of protein homooligomerization Source: BHF-UCL
    15. positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway Source: Reactome
    16. positive regulation of protein oligomerization Source: UniProtKB
    17. positive regulation of release of cytochrome c from mitochondria Source: UniProtKB
    18. protein homooligomerization Source: Ensembl
    19. protein targeting to mitochondrion Source: Ensembl
    20. regulation of cell proliferation Source: Ensembl
    21. regulation of G1/S transition of mitotic cell cycle Source: Ensembl
    22. regulation of mitochondrial membrane permeability involved in apoptotic process Source: Ensembl
    23. release of cytochrome c from mitochondria Source: HGNC
    24. response to estradiol Source: Ensembl
    25. signal transduction in response to DNA damage Source: UniProtKB

    Keywords - Biological processi

    Apoptosis

    Enzyme and pathway databases

    ReactomeiREACT_330. BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members.
    REACT_584. Activation, translocation and oligomerization of BAX.
    REACT_701. Activation, myristolyation of BID and translocation to mitochondria.
    REACT_707. Activation and oligomerization of BAK protein.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    BH3-interacting domain death agonist
    Alternative name(s):
    p22 BID
    Short name:
    BID
    Cleaved into the following 3 chains:
    Alternative name(s):
    p15 BID
    Alternative name(s):
    p13 BID
    Alternative name(s):
    p11 BID
    Gene namesi
    Name:BID
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 22

    Organism-specific databases

    HGNCiHGNC:1050. BID.

    Subcellular locationi

    Cytoplasm By similarity. Mitochondrion membrane By similarity
    Note: When uncleaved, it is predominantly cytoplasmic.1 Publication
    Chain BH3-interacting domain death agonist p15 : Mitochondrion membrane By similarity
    Note: Translocates to mitochondria as an integral membrane protein.By similarity
    Chain BH3-interacting domain death agonist p13 : Mitochondrion membrane By similarity
    Note: Associated with the mitochondrial membrane.By similarity
    Isoform 2 : Mitochondrion membrane
    Note: A significant proportion of isoform 2 localizes to mitochondria, it may be cleaved constitutively.

    GO - Cellular componenti

    1. cytosol Source: Reactome
    2. extracellular vesicular exosome Source: UniProt
    3. integral component of mitochondrial membrane Source: Ensembl
    4. membrane Source: ProtInc
    5. mitochondrial outer membrane Source: Reactome
    6. mitochondrion Source: ProtInc

    Keywords - Cellular componenti

    Cytoplasm, Membrane, Mitochondrion

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA25353.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 195195BH3-interacting domain death agonistPRO_0000143101Add
    BLAST
    Chaini62 – 195134BH3-interacting domain death agonist p15By similarityPRO_0000223233Add
    BLAST
    Chaini77 – 195119BH3-interacting domain death agonist p13By similarityPRO_0000223232Add
    BLAST
    Chaini100 – 19596BH3-interacting domain death agonist p11By similarityPRO_0000223231Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei1 – 11N-acetylmethionine1 Publication
    Modified residuei54 – 541Phosphotyrosine1 Publication
    Modified residuei78 – 781Phosphoserine1 Publication

    Post-translational modificationi

    TNF-alpha induces a caspase-mediated cleavage of p22 BID into a major p15 and minor p13 and p11 products.By similarity
    p15 BID is ubiquitinated by ITCH; ubiquitination results in proteasome-dependent degradation.1 Publication

    Keywords - PTMi

    Acetylation, Phosphoprotein, Ubl conjugation

    Proteomic databases

    MaxQBiP55957.
    PaxDbiP55957.
    PRIDEiP55957.

    2D gel databases

    OGPiP55957.

    PTM databases

    PhosphoSiteiP55957.

    Miscellaneous databases

    PMAP-CutDBP55957.

    Expressioni

    Tissue specificityi

    Isoform 2 and isoform 3 are expressed in spleen, bone marrow, cerebral and cerebellar cortex. Isoform 2 is expressed in spleen, pancreas and placenta (at protein level). Isoform 3 is expressed in lung, pancreas and spleen (at protein level). Isoform 4 is expressed in lung and pancreas (at protein level).1 Publication

    Gene expression databases

    ArrayExpressiP55957.
    BgeeiP55957.
    CleanExiHS_BID.
    GenevestigatoriP55957.

    Organism-specific databases

    HPAiCAB003771.
    HPA000722.

    Interactioni

    Subunit structurei

    Forms heterodimers either with the pro-apoptotic protein BAX or the anti-apoptotic protein Bcl-2 By similarity. p15 BID interacts with ITCH.By similarity1 Publication

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    BAK1Q166112EBI-519672,EBI-519866
    BAXQ0781216EBI-519672,EBI-516580
    BCL2P104158EBI-519672,EBI-77694
    Bcl2a1Q074403EBI-519672,EBI-707754From a different organism.
    BCL2L1Q078172EBI-519672,EBI-78035
    BCL2L1Q07817-16EBI-519672,EBI-287195
    BCL2L2Q928435EBI-519672,EBI-707714
    CAV1Q031353EBI-519672,EBI-603614
    VACWR028P173612EBI-519672,EBI-7115640From a different organism.

    Protein-protein interaction databases

    BioGridi107106. 43 interactions.
    DIPiDIP-34937N.
    IntActiP55957. 32 interactions.
    MINTiMINT-270277.
    STRINGi9606.ENSP00000318822.

    Structurei

    Secondary structure

    1
    195
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi15 – 2713
    Beta strandi31 – 333
    Helixi34 – 407
    Helixi41 – 433
    Helixi77 – 9620
    Helixi97 – 993
    Beta strandi100 – 1023
    Helixi106 – 1149
    Helixi116 – 1183
    Helixi119 – 13517
    Helixi145 – 16218
    Helixi167 – 17913
    Turni180 – 1823
    Helixi183 – 1919

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1ZY3NMR-B82-101[»]
    2BIDNMR-A1-195[»]
    2KBWNMR-B76-106[»]
    2M5BNMR-B80-101[»]
    2M5INMR-A61-195[»]
    4BD2X-ray2.21C76-109[»]
    ProteinModelPortaliP55957.
    SMRiP55957. Positions 1-195.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiP55957.

    Family & Domainsi

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi86 – 10015BH3Add
    BLAST

    Domaini

    Intact BH3 motif is required by BIK, BID, BAK, BAD and BAX for their pro-apoptotic activity and for their interaction with anti-apoptotic members of the Bcl-2 family.

    Phylogenomic databases

    eggNOGiNOG78659.
    HOGENOMiHOG000010016.
    HOVERGENiHBG001703.
    InParanoidiP55957.
    KOiK04726.
    OMAiKVADHTP.
    OrthoDBiEOG73V6MW.
    PhylomeDBiP55957.
    TreeFamiTF102047.

    Family and domain databases

    InterProiIPR020728. Bcl2_BH3_motif_CS.
    IPR010479. BID.
    [Graphical view]
    PfamiPF06393. BID. 1 hit.
    [Graphical view]
    PIRSFiPIRSF038018. BID. 1 hit.
    PROSITEiPS01259. BH3. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P55957-1) [UniParc]FASTAAdd to Basket

    Also known as: BID(L)

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MDCEVNNGSS LRDECITNLL VFGFLQSCSD NSFRRELDAL GHELPVLAPQ    50
    WEGYDELQTD GNRSSHSRLG RIEADSESQE DIIRNIARHL AQVGDSMDRS 100
    IPPGLVNGLA LQLRNTSRSE EDRNRDLATA LEQLLQAYPR DMEKEKTMLV 150
    LALLLAKKVA SHTPSLLRDV FHTTVNFINQ NLRTYVRSLA RNGMD 195
    Length:195
    Mass (Da):21,995
    Last modified:November 1, 1997 - v1
    Checksum:iB17A07334C1AFBEF
    GO
    Isoform 2 (identifier: P55957-2) [UniParc]FASTAAdd to Basket

    Also known as: BID(EL)

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MCSGAGVMMARWAARGRAGWRSTVRILSPLGHCEPGVSRSCRAAQAM

    Show »
    Length:241
    Mass (Da):26,836
    Checksum:i437706F65542B380
    GO
    Isoform 3 (identifier: P55957-3) [UniParc]FASTAAdd to Basket

    Also known as: BID(S)

    The sequence of this isoform differs from the canonical sequence as follows:
         75-137: DSESQEDIIR...ATALEQLLQA → GASDNNTASA...AWTVASLRAW
         138-195: Missing.

    Show »
    Length:137
    Mass (Da):14,620
    Checksum:i00B4D060E01FA1B8
    GO
    Isoform 4 (identifier: P55957-4) [UniParc]FASTAAdd to Basket

    Also known as: BID(ES)

    The sequence of this isoform differs from the canonical sequence as follows:
         1-96: Missing.

    Show »
    Length:99
    Mass (Da):11,263
    Checksum:i482F50C9C7DF86B0
    GO

    Sequence cautioni

    The sequence AAH22072.2 differs from that shown. Reason: Erroneous initiation.

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti10 – 101S → G.1 Publication
    Corresponds to variant rs8190315 [ dbSNP | Ensembl ].
    VAR_018845
    Natural varianti162 – 1621H → Q.1 Publication
    Corresponds to variant rs17853595 [ dbSNP | Ensembl ].
    VAR_025332
    Natural varianti194 – 1941M → T.
    Corresponds to variant rs59225839 [ dbSNP | Ensembl ].
    VAR_061041

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 9696Missing in isoform 4. 1 PublicationVSP_017266Add
    BLAST
    Alternative sequencei1 – 11M → MCSGAGVMMARWAARGRAGW RSTVRILSPLGHCEPGVSRS CRAAQAM in isoform 2. 2 PublicationsVSP_017267
    Alternative sequencei75 – 13763DSESQ…QLLQA → GASDNNTASAEEETEAAGSV AVERGLHGAATVILKVKKTS SGILPGTSPRSGTAWTVASL RAW in isoform 3. 1 PublicationVSP_017268Add
    BLAST
    Alternative sequencei138 – 19558Missing in isoform 3. 1 PublicationVSP_017269Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF042083 mRNA. Translation: AAC34365.1.
    AF250233 mRNA. Translation: AAO32633.1.
    AY005151 mRNA. Translation: AAF89091.1.
    AF087891 mRNA. Translation: AAP97190.1.
    CR456389 mRNA. Translation: CAG30275.1.
    CR407603 mRNA. Translation: CAG28531.1.
    AY309922 Genomic DNA. Translation: AAP50259.1.
    BC009197 mRNA. Translation: AAH09197.1.
    BC022072 mRNA. Translation: AAH22072.2. Different initiation.
    BC033634 mRNA. Translation: AAH33634.1.
    BC036364 mRNA. Translation: AAH36364.2.
    CCDSiCCDS13747.1. [P55957-2]
    CCDS13748.1. [P55957-1]
    CCDS13749.1. [P55957-4]
    RefSeqiNP_001187.1. NM_001196.3. [P55957-1]
    NP_001231496.1. NM_001244567.1. [P55957-1]
    NP_001231498.1. NM_001244569.1. [P55957-4]
    NP_001231499.1. NM_001244570.1. [P55957-4]
    NP_001231501.1. NM_001244572.1. [P55957-4]
    NP_932070.1. NM_197966.2. [P55957-2]
    NP_932071.1. NM_197967.2. [P55957-4]
    UniGeneiHs.591054.

    Genome annotation databases

    EnsembliENST00000317361; ENSP00000318822; ENSG00000015475. [P55957-2]
    ENST00000342111; ENSP00000344594; ENSG00000015475. [P55957-3]
    ENST00000399765; ENSP00000382667; ENSG00000015475. [P55957-4]
    ENST00000399767; ENSP00000382669; ENSG00000015475. [P55957-4]
    ENST00000399774; ENSP00000382674; ENSG00000015475. [P55957-1]
    ENST00000551952; ENSP00000449236; ENSG00000015475. [P55957-1]
    GeneIDi637.
    KEGGihsa:637.
    UCSCiuc002znc.2. human. [P55957-2]
    uc002znd.2. human. [P55957-1]

    Polymorphism databases

    DMDMi2493285.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    NIEHS-SNPs

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF042083 mRNA. Translation: AAC34365.1 .
    AF250233 mRNA. Translation: AAO32633.1 .
    AY005151 mRNA. Translation: AAF89091.1 .
    AF087891 mRNA. Translation: AAP97190.1 .
    CR456389 mRNA. Translation: CAG30275.1 .
    CR407603 mRNA. Translation: CAG28531.1 .
    AY309922 Genomic DNA. Translation: AAP50259.1 .
    BC009197 mRNA. Translation: AAH09197.1 .
    BC022072 mRNA. Translation: AAH22072.2 . Different initiation.
    BC033634 mRNA. Translation: AAH33634.1 .
    BC036364 mRNA. Translation: AAH36364.2 .
    CCDSi CCDS13747.1. [P55957-2 ]
    CCDS13748.1. [P55957-1 ]
    CCDS13749.1. [P55957-4 ]
    RefSeqi NP_001187.1. NM_001196.3. [P55957-1 ]
    NP_001231496.1. NM_001244567.1. [P55957-1 ]
    NP_001231498.1. NM_001244569.1. [P55957-4 ]
    NP_001231499.1. NM_001244570.1. [P55957-4 ]
    NP_001231501.1. NM_001244572.1. [P55957-4 ]
    NP_932070.1. NM_197966.2. [P55957-2 ]
    NP_932071.1. NM_197967.2. [P55957-4 ]
    UniGenei Hs.591054.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1ZY3 NMR - B 82-101 [» ]
    2BID NMR - A 1-195 [» ]
    2KBW NMR - B 76-106 [» ]
    2M5B NMR - B 80-101 [» ]
    2M5I NMR - A 61-195 [» ]
    4BD2 X-ray 2.21 C 76-109 [» ]
    ProteinModelPortali P55957.
    SMRi P55957. Positions 1-195.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 107106. 43 interactions.
    DIPi DIP-34937N.
    IntActi P55957. 32 interactions.
    MINTi MINT-270277.
    STRINGi 9606.ENSP00000318822.

    Chemistry

    BindingDBi P55957.

    PTM databases

    PhosphoSitei P55957.

    Polymorphism databases

    DMDMi 2493285.

    2D gel databases

    OGPi P55957.

    Proteomic databases

    MaxQBi P55957.
    PaxDbi P55957.
    PRIDEi P55957.

    Protocols and materials databases

    DNASUi 637.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000317361 ; ENSP00000318822 ; ENSG00000015475 . [P55957-2 ]
    ENST00000342111 ; ENSP00000344594 ; ENSG00000015475 . [P55957-3 ]
    ENST00000399765 ; ENSP00000382667 ; ENSG00000015475 . [P55957-4 ]
    ENST00000399767 ; ENSP00000382669 ; ENSG00000015475 . [P55957-4 ]
    ENST00000399774 ; ENSP00000382674 ; ENSG00000015475 . [P55957-1 ]
    ENST00000551952 ; ENSP00000449236 ; ENSG00000015475 . [P55957-1 ]
    GeneIDi 637.
    KEGGi hsa:637.
    UCSCi uc002znc.2. human. [P55957-2 ]
    uc002znd.2. human. [P55957-1 ]

    Organism-specific databases

    CTDi 637.
    GeneCardsi GC22M018216.
    HGNCi HGNC:1050. BID.
    HPAi CAB003771.
    HPA000722.
    MIMi 601997. gene.
    neXtProti NX_P55957.
    PharmGKBi PA25353.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG78659.
    HOGENOMi HOG000010016.
    HOVERGENi HBG001703.
    InParanoidi P55957.
    KOi K04726.
    OMAi KVADHTP.
    OrthoDBi EOG73V6MW.
    PhylomeDBi P55957.
    TreeFami TF102047.

    Enzyme and pathway databases

    Reactomei REACT_330. BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members.
    REACT_584. Activation, translocation and oligomerization of BAX.
    REACT_701. Activation, myristolyation of BID and translocation to mitochondria.
    REACT_707. Activation and oligomerization of BAK protein.

    Miscellaneous databases

    ChiTaRSi BID. human.
    EvolutionaryTracei P55957.
    GeneWikii BH3_interacting-domain_death_agonist.
    BH3_interacting_domain_death_agonist.
    GenomeRNAii 637.
    NextBioi 2578.
    PMAP-CutDB P55957.
    PROi P55957.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P55957.
    Bgeei P55957.
    CleanExi HS_BID.
    Genevestigatori P55957.

    Family and domain databases

    InterProi IPR020728. Bcl2_BH3_motif_CS.
    IPR010479. BID.
    [Graphical view ]
    Pfami PF06393. BID. 1 hit.
    [Graphical view ]
    PIRSFi PIRSF038018. BID. 1 hit.
    PROSITEi PS01259. BH3. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE (ISOFORM 1).
    2. "The gene for death agonist BID maps to the region of human 22q11.2 duplicated in cat eye syndrome chromosomes and to mouse chromosome 6."
      Footz T.K., Birren B., Minoshima S., Asakawa S., Shimizu N., Riazi M.A., McDermid H.E.
      Genomics 51:472-475(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    3. "Three novel Bid proteins generated by alternative splicing of the human Bid gene."
      Renshaw S.A., Dempsey C.E., Barnes F.A., Bagstaff S.M., Dower S.K., Bingle C.D., Whyte M.K.
      J. Biol. Chem. 279:2846-2855(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, FUNCTION.
    4. "Cloning and expression of a new human cDNA homology to murine apoptic death agonist (BID) mRNA."
      Dai F.Y., Yu L., Huang H.B., Jiang C.L., Cui Y.Y., Zhao S.Y.
      Submitted (JUL-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    6. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
      Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
      Submitted (MAY-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    7. NIEHS SNPs program
      Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT GLY-10.
    8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT GLN-162.
      Tissue: Brain and Skin.
    9. "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells."
      Rush J., Moritz A., Lee K.A., Guo A., Goss V.L., Spek E.J., Zhang H., Zha X.-M., Polakiewicz R.D., Comb M.J.
      Nat. Biotechnol. 23:94-101(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-54, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    10. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-78, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Embryonic kidney.
    11. "The ubiquitin ligase Itch mediates the antiapoptotic activity of epidermal growth factor by promoting the ubiquitylation and degradation of the truncated C-terminal portion of Bid."
      Azakir B.A., Desrochers G., Angers A.
      FEBS J. 277:1319-1330(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH ITCH, UBIQUITINATION BY ITCH.
    12. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    13. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    14. "Solution structure of BID, an intracellular amplifier of apoptotic signaling."
      Chou J.J., Li H., Salvesen G.S., Yuan J., Wagner G.
      Cell 96:615-624(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: STRUCTURE BY NMR.

    Entry informationi

    Entry nameiBID_HUMAN
    AccessioniPrimary (citable) accession number: P55957
    Secondary accession number(s): Q549M7
    , Q71T04, Q7Z4M9, Q8IY86
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 1997
    Last sequence update: November 1, 1997
    Last modified: October 1, 2014
    This is version 148 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 22
      Human chromosome 22: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references

    External Data

    Dasty 3