Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

BH3-interacting domain death agonist

Gene

BID

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

The major proteolytic product p15 BID allows the release of cytochrome c (By similarity). Isoform 1, isoform 2 and isoform 4 induce ICE-like proteases and apoptosis. Isoform 3 does not induce apoptosis. Counters the protective effect of Bcl-2.By similarity1 Publication

GO - Molecular functioni

  • death receptor binding Source: ProtInc

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Apoptosis

Enzyme and pathway databases

BioCyciZFISH:ENSG00000015475-MONOMER.
ReactomeiR-HSA-111447. Activation of BAD and translocation to mitochondria.
R-HSA-111452. Activation and oligomerization of BAK protein.
R-HSA-111453. BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members.
R-HSA-114294. Activation, translocation and oligomerization of BAX.
R-HSA-6803204. TP53 Regulates Transcription of Genes Involved in Cytochrome C Release.
R-HSA-75108. Activation, myristolyation of BID and translocation to mitochondria.
SIGNORiP55957.

Names & Taxonomyi

Protein namesi
Recommended name:
BH3-interacting domain death agonist
Alternative name(s):
p22 BID
Short name:
BID
Cleaved into the following 3 chains:
Alternative name(s):
p15 BID
Alternative name(s):
p13 BID
Alternative name(s):
p11 BID
Gene namesi
Name:BID
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 22

Organism-specific databases

HGNCiHGNC:1050. BID.

Subcellular locationi

BH3-interacting domain death agonist p15 :
  • Mitochondrion membrane By similarity

  • Note: Translocates to mitochondria as an integral membrane protein.By similarity
BH3-interacting domain death agonist p13 :
Isoform 2 :
  • Mitochondrion membrane

  • Note: A significant proportion of isoform 2 localizes to mitochondria, it may be cleaved constitutively.

GO - Cellular componenti

  • cytosol Source: Reactome
  • extracellular exosome Source: UniProtKB
  • integral component of mitochondrial membrane Source: Ensembl
  • membrane Source: ProtInc
  • mitochondrial outer membrane Source: Reactome
  • mitochondrion Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Membrane, Mitochondrion

Pathology & Biotechi

Organism-specific databases

DisGeNETi637.
OpenTargetsiENSG00000015475.
PharmGKBiPA25353.

Polymorphism and mutation databases

BioMutaiBID.
DMDMi2493285.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001431011 – 195BH3-interacting domain death agonistAdd BLAST195
ChainiPRO_000022323362 – 195BH3-interacting domain death agonist p15By similarityAdd BLAST134
ChainiPRO_000022323277 – 195BH3-interacting domain death agonist p13By similarityAdd BLAST119
ChainiPRO_0000223231100 – 195BH3-interacting domain death agonist p11By similarityAdd BLAST96

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1
Modified residuei54PhosphotyrosineCombined sources1
Modified residuei78PhosphoserineCombined sources1

Post-translational modificationi

TNF-alpha induces a caspase-mediated cleavage of p22 BID into a major p15 and minor p13 and p11 products.By similarity
p15 BID is ubiquitinated by ITCH; ubiquitination results in proteasome-dependent degradation.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei61 – 62CleavageBy similarity2
Sitei76 – 77CleavageBy similarity2
Sitei99 – 100CleavageBy similarity2

Keywords - PTMi

Acetylation, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiP55957.
MaxQBiP55957.
PaxDbiP55957.
PeptideAtlasiP55957.
PRIDEiP55957.
TopDownProteomicsiP55957-1. [P55957-1]
P55957-4. [P55957-4]

2D gel databases

OGPiP55957.

PTM databases

iPTMnetiP55957.
PhosphoSitePlusiP55957.

Miscellaneous databases

PMAP-CutDBP55957.

Expressioni

Tissue specificityi

Isoform 2 and isoform 3 are expressed in spleen, bone marrow, cerebral and cerebellar cortex. Isoform 2 is expressed in spleen, pancreas and placenta (at protein level). Isoform 3 is expressed in lung, pancreas and spleen (at protein level). Isoform 4 is expressed in lung and pancreas (at protein level).1 Publication

Gene expression databases

BgeeiENSG00000015475.
CleanExiHS_BID.
ExpressionAtlasiP55957. baseline and differential.
GenevisibleiP55957. HS.

Organism-specific databases

HPAiCAB003771.
HPA000722.

Interactioni

Subunit structurei

Forms heterodimers either with the pro-apoptotic protein BAX or the anti-apoptotic protein Bcl-2 (By similarity). p15 BID interacts with ITCH.By similarity1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
AHCYL1O438653EBI-519672,EBI-2371423
BAK1Q166112EBI-519672,EBI-519866
BAXQ0781216EBI-519672,EBI-516580
BCL2P104158EBI-519672,EBI-77694
Bcl2a1Q074403EBI-519672,EBI-707754From a different organism.
BCL2L1Q078172EBI-519672,EBI-78035
BCL2L1Q07817-16EBI-519672,EBI-287195
BCL2L2Q928435EBI-519672,EBI-707714
CAV1Q031353EBI-519672,EBI-603614
RELQ048643EBI-519672,EBI-307352
VACWR028P173612EBI-519672,EBI-7115640From a different organism.

GO - Molecular functioni

  • death receptor binding Source: ProtInc

Protein-protein interaction databases

BioGridi107106. 53 interactors.
DIPiDIP-34937N.
IntActiP55957. 34 interactors.
MINTiMINT-270277.
STRINGi9606.ENSP00000318822.

Structurei

Secondary structure

1195
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi15 – 27Combined sources13
Beta strandi31 – 33Combined sources3
Helixi34 – 40Combined sources7
Helixi41 – 43Combined sources3
Helixi81 – 100Combined sources20
Turni102 – 105Combined sources4
Helixi106 – 114Combined sources9
Helixi116 – 118Combined sources3
Helixi119 – 135Combined sources17
Helixi145 – 162Combined sources18
Helixi167 – 179Combined sources13
Turni180 – 182Combined sources3
Helixi183 – 191Combined sources9

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1ZY3NMR-B82-101[»]
2BIDNMR-A1-195[»]
2KBWNMR-B76-106[»]
2M5BNMR-B80-101[»]
2M5INMR-A61-195[»]
4BD2X-ray2.21C76-109[»]
4QVEX-ray2.05B76-109[»]
4ZEQX-ray1.80B79-104[»]
4ZIGX-ray2.20B79-98[»]
4ZIIX-ray2.19C76-109[»]
5AJJX-ray1.75B79-112[»]
5C3FX-ray1.43B80-101[»]
ProteinModelPortaliP55957.
SMRiP55957.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP55957.

Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi86 – 100BH3Add BLAST15

Domaini

Intact BH3 motif is required by BIK, BID, BAK, BAD and BAX for their pro-apoptotic activity and for their interaction with anti-apoptotic members of the Bcl-2 family.

Phylogenomic databases

eggNOGiENOG410IVZ7. Eukaryota.
ENOG410ZF8F. LUCA.
GeneTreeiENSGT00390000002868.
HOGENOMiHOG000010016.
HOVERGENiHBG001703.
InParanoidiP55957.
KOiK04726.
OMAiRDVFRTT.
OrthoDBiEOG091G0LRX.
PhylomeDBiP55957.
TreeFamiTF102047.

Family and domain databases

InterProiIPR020728. Bcl2_BH3_motif_CS.
IPR010479. BID.
[Graphical view]
PfamiPF06393. BID. 1 hit.
[Graphical view]
PIRSFiPIRSF038018. BID. 1 hit.
PROSITEiPS01259. BH3. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P55957-1) [UniParc]FASTAAdd to basket
Also known as: BID(L)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDCEVNNGSS LRDECITNLL VFGFLQSCSD NSFRRELDAL GHELPVLAPQ
60 70 80 90 100
WEGYDELQTD GNRSSHSRLG RIEADSESQE DIIRNIARHL AQVGDSMDRS
110 120 130 140 150
IPPGLVNGLA LQLRNTSRSE EDRNRDLATA LEQLLQAYPR DMEKEKTMLV
160 170 180 190
LALLLAKKVA SHTPSLLRDV FHTTVNFINQ NLRTYVRSLA RNGMD
Length:195
Mass (Da):21,995
Last modified:November 1, 1997 - v1
Checksum:iB17A07334C1AFBEF
GO
Isoform 2 (identifier: P55957-2) [UniParc]FASTAAdd to basket
Also known as: BID(EL)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MCSGAGVMMARWAARGRAGWRSTVRILSPLGHCEPGVSRSCRAAQAM

Show »
Length:241
Mass (Da):26,836
Checksum:i437706F65542B380
GO
Isoform 3 (identifier: P55957-3) [UniParc]FASTAAdd to basket
Also known as: BID(S)

The sequence of this isoform differs from the canonical sequence as follows:
     75-137: DSESQEDIIR...ATALEQLLQA → GASDNNTASA...AWTVASLRAW
     138-195: Missing.

Show »
Length:137
Mass (Da):14,620
Checksum:i00B4D060E01FA1B8
GO
Isoform 4 (identifier: P55957-4) [UniParc]FASTAAdd to basket
Also known as: BID(ES)

The sequence of this isoform differs from the canonical sequence as follows:
     1-96: Missing.

Show »
Length:99
Mass (Da):11,263
Checksum:i482F50C9C7DF86B0
GO

Sequence cautioni

The sequence AAH22072 differs from that shown. Reason: Erroneous initiation.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_01884510S → G.1 PublicationCorresponds to variant rs8190315dbSNPEnsembl.1
Natural variantiVAR_025332162H → Q.1 PublicationCorresponds to variant rs17853595dbSNPEnsembl.1
Natural variantiVAR_061041194M → T.Corresponds to variant rs59225839dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0172661 – 96Missing in isoform 4. 1 PublicationAdd BLAST96
Alternative sequenceiVSP_0172671M → MCSGAGVMMARWAARGRAGW RSTVRILSPLGHCEPGVSRS CRAAQAM in isoform 2. 2 Publications1
Alternative sequenceiVSP_01726875 – 137DSESQ…QLLQA → GASDNNTASAEEETEAAGSV AVERGLHGAATVILKVKKTS SGILPGTSPRSGTAWTVASL RAW in isoform 3. 1 PublicationAdd BLAST63
Alternative sequenceiVSP_017269138 – 195Missing in isoform 3. 1 PublicationAdd BLAST58

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF042083 mRNA. Translation: AAC34365.1.
AF250233 mRNA. Translation: AAO32633.1.
AY005151 mRNA. Translation: AAF89091.1.
AF087891 mRNA. Translation: AAP97190.1.
CR456389 mRNA. Translation: CAG30275.1.
CR407603 mRNA. Translation: CAG28531.1.
AY309922 Genomic DNA. Translation: AAP50259.1.
BC009197 mRNA. Translation: AAH09197.1.
BC022072 mRNA. Translation: AAH22072.2. Different initiation.
BC033634 mRNA. Translation: AAH33634.1.
BC036364 mRNA. Translation: AAH36364.2.
CCDSiCCDS13747.1. [P55957-2]
CCDS13748.1. [P55957-1]
CCDS13749.1. [P55957-4]
RefSeqiNP_001187.1. NM_001196.3. [P55957-1]
NP_001231496.1. NM_001244567.1. [P55957-1]
NP_001231498.1. NM_001244569.1. [P55957-4]
NP_001231499.1. NM_001244570.1. [P55957-4]
NP_001231501.1. NM_001244572.1. [P55957-4]
NP_932070.1. NM_197966.2. [P55957-2]
NP_932071.1. NM_197967.2. [P55957-4]
UniGeneiHs.517145.
Hs.591054.

Genome annotation databases

EnsembliENST00000317361; ENSP00000318822; ENSG00000015475. [P55957-2]
ENST00000342111; ENSP00000344594; ENSG00000015475. [P55957-3]
ENST00000399765; ENSP00000382667; ENSG00000015475. [P55957-4]
ENST00000399767; ENSP00000382669; ENSG00000015475. [P55957-4]
ENST00000399774; ENSP00000382674; ENSG00000015475. [P55957-1]
ENST00000551952; ENSP00000449236; ENSG00000015475. [P55957-1]
ENST00000611040; ENSP00000483709; ENSG00000015475. [P55957-4]
ENST00000614949; ENSP00000477773; ENSG00000015475. [P55957-4]
ENST00000615414; ENSP00000483534; ENSG00000015475. [P55957-4]
ENST00000622694; ENSP00000480414; ENSG00000015475. [P55957-1]
GeneIDi637.
KEGGihsa:637.
UCSCiuc002znc.3. human. [P55957-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF042083 mRNA. Translation: AAC34365.1.
AF250233 mRNA. Translation: AAO32633.1.
AY005151 mRNA. Translation: AAF89091.1.
AF087891 mRNA. Translation: AAP97190.1.
CR456389 mRNA. Translation: CAG30275.1.
CR407603 mRNA. Translation: CAG28531.1.
AY309922 Genomic DNA. Translation: AAP50259.1.
BC009197 mRNA. Translation: AAH09197.1.
BC022072 mRNA. Translation: AAH22072.2. Different initiation.
BC033634 mRNA. Translation: AAH33634.1.
BC036364 mRNA. Translation: AAH36364.2.
CCDSiCCDS13747.1. [P55957-2]
CCDS13748.1. [P55957-1]
CCDS13749.1. [P55957-4]
RefSeqiNP_001187.1. NM_001196.3. [P55957-1]
NP_001231496.1. NM_001244567.1. [P55957-1]
NP_001231498.1. NM_001244569.1. [P55957-4]
NP_001231499.1. NM_001244570.1. [P55957-4]
NP_001231501.1. NM_001244572.1. [P55957-4]
NP_932070.1. NM_197966.2. [P55957-2]
NP_932071.1. NM_197967.2. [P55957-4]
UniGeneiHs.517145.
Hs.591054.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1ZY3NMR-B82-101[»]
2BIDNMR-A1-195[»]
2KBWNMR-B76-106[»]
2M5BNMR-B80-101[»]
2M5INMR-A61-195[»]
4BD2X-ray2.21C76-109[»]
4QVEX-ray2.05B76-109[»]
4ZEQX-ray1.80B79-104[»]
4ZIGX-ray2.20B79-98[»]
4ZIIX-ray2.19C76-109[»]
5AJJX-ray1.75B79-112[»]
5C3FX-ray1.43B80-101[»]
ProteinModelPortaliP55957.
SMRiP55957.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107106. 53 interactors.
DIPiDIP-34937N.
IntActiP55957. 34 interactors.
MINTiMINT-270277.
STRINGi9606.ENSP00000318822.

PTM databases

iPTMnetiP55957.
PhosphoSitePlusiP55957.

Polymorphism and mutation databases

BioMutaiBID.
DMDMi2493285.

2D gel databases

OGPiP55957.

Proteomic databases

EPDiP55957.
MaxQBiP55957.
PaxDbiP55957.
PeptideAtlasiP55957.
PRIDEiP55957.
TopDownProteomicsiP55957-1. [P55957-1]
P55957-4. [P55957-4]

Protocols and materials databases

DNASUi637.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000317361; ENSP00000318822; ENSG00000015475. [P55957-2]
ENST00000342111; ENSP00000344594; ENSG00000015475. [P55957-3]
ENST00000399765; ENSP00000382667; ENSG00000015475. [P55957-4]
ENST00000399767; ENSP00000382669; ENSG00000015475. [P55957-4]
ENST00000399774; ENSP00000382674; ENSG00000015475. [P55957-1]
ENST00000551952; ENSP00000449236; ENSG00000015475. [P55957-1]
ENST00000611040; ENSP00000483709; ENSG00000015475. [P55957-4]
ENST00000614949; ENSP00000477773; ENSG00000015475. [P55957-4]
ENST00000615414; ENSP00000483534; ENSG00000015475. [P55957-4]
ENST00000622694; ENSP00000480414; ENSG00000015475. [P55957-1]
GeneIDi637.
KEGGihsa:637.
UCSCiuc002znc.3. human. [P55957-1]

Organism-specific databases

CTDi637.
DisGeNETi637.
GeneCardsiBID.
HGNCiHGNC:1050. BID.
HPAiCAB003771.
HPA000722.
MIMi601997. gene.
neXtProtiNX_P55957.
OpenTargetsiENSG00000015475.
PharmGKBiPA25353.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IVZ7. Eukaryota.
ENOG410ZF8F. LUCA.
GeneTreeiENSGT00390000002868.
HOGENOMiHOG000010016.
HOVERGENiHBG001703.
InParanoidiP55957.
KOiK04726.
OMAiRDVFRTT.
OrthoDBiEOG091G0LRX.
PhylomeDBiP55957.
TreeFamiTF102047.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000015475-MONOMER.
ReactomeiR-HSA-111447. Activation of BAD and translocation to mitochondria.
R-HSA-111452. Activation and oligomerization of BAK protein.
R-HSA-111453. BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members.
R-HSA-114294. Activation, translocation and oligomerization of BAX.
R-HSA-6803204. TP53 Regulates Transcription of Genes Involved in Cytochrome C Release.
R-HSA-75108. Activation, myristolyation of BID and translocation to mitochondria.
SIGNORiP55957.

Miscellaneous databases

ChiTaRSiBID. human.
EvolutionaryTraceiP55957.
GeneWikiiBH3_interacting-domain_death_agonist.
BH3_interacting_domain_death_agonist.
GenomeRNAii637.
PMAP-CutDBP55957.
PROiP55957.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000015475.
CleanExiHS_BID.
ExpressionAtlasiP55957. baseline and differential.
GenevisibleiP55957. HS.

Family and domain databases

InterProiIPR020728. Bcl2_BH3_motif_CS.
IPR010479. BID.
[Graphical view]
PfamiPF06393. BID. 1 hit.
[Graphical view]
PIRSFiPIRSF038018. BID. 1 hit.
PROSITEiPS01259. BH3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiBID_HUMAN
AccessioniPrimary (citable) accession number: P55957
Secondary accession number(s): Q549M7
, Q71T04, Q7Z4M9, Q8IY86
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 1, 1997
Last modified: November 30, 2016
This is version 171 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.