Reviewed,
UniProtKB/Swiss-Prot P55957 (BID_HUMAN)
Last modified
February 9, 2010.
Version 100.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: BH3-interacting domain death agonist Alternative name(s): p22 BID Short name=BID Cleaved into the following 3 chains: 1- Recommended name: BH3-interacting domain death agonist p15 Alternative name(s): p15 BID 2- Recommended name: BH3-interacting domain death agonist p13 Alternative name(s): p13 BID 3- Recommended name: BH3-interacting domain death agonist p11 Alternative name(s): p11 BID | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Complete proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 195 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | The major proteolytic product p15 BID allows the release of cytochrome c By similarity. Isoform 1, isoform 2 and isoform 4 induce ICE-like proteases and apoptosis. Isoform 3 does not induce apoptosis. Counters the protective effect of Bcl-2. Ref.3 |
| Subunit structure | Forms heterodimers either with the pro-apoptotic protein BAX or the anti-apoptotic protein Bcl-2 By similarity. |
| Subcellular location | Cytoplasm By similarity. Mitochondrion membrane By similarity. Note: When uncleaved, it is predominantly cytoplasmic. Ref.3 BH3-interacting domain death agonist p15: Mitochondrion membrane By similarity. Note: Translocates to mitochondria as an integral membrane protein By similarity. Ref.3 BH3-interacting domain death agonist p13: Mitochondrion membrane By similarity. Note: Associated with the mitochondrial membrane By similarity. Ref.3 Isoform 2: Mitochondrion membrane. Note: A significant proportion of isoform 2 localizes to mitochondria, it may be cleaved constitutively. Ref.3 |
| Tissue specificity | Isoform 2 and isoform 3 are expressed in spleen, bone marrow, cerebral and cerebellar cortex. Isoform 2 is expressed in spleen, pancreas and placenta (at protein level). Isoform 3 is expressed in lung, pancreas and spleen (at protein level). Isoform 4 is expressed in lung and pancreas (at protein level). Ref.3 |
| Domain | Intact BH3 motif is required by BIK, BID, BAK, BAD and BAX for their pro-apoptotic activity and for their interaction with anti-apoptotic members of the Bcl-2 family. |
| Post-translational modification | TNF-alpha induces a caspase-mediated cleavage of p22 BID into a major p15 and minor p13 and p11 products By similarity. Phosphorylated upon DNA damage, probably by ATM or ATR. Ref.9 Ref.10 |
Ontologies
| Keywords | |
|---|---|
| Biological process | Apoptosis |
| Cellular component | Cytoplasm Membrane Mitochondrion |
| Coding sequence diversity | Alternative splicing Polymorphism |
| PTM | Phosphoprotein |
| Technical term | 3D-structure Complete proteome |
| Gene Ontology (GO) | |
| Biological process | activation of pro-apoptotic gene products Inferred from Experiment. Source: Reactome induction of apoptosis via death domain receptorsTraceable author statement. Source: ProtInc neuron apoptosisTraceable author statement. Source: HGNC release of cytochrome c from mitochondriaInferred from direct assay. Source: HGNC |
| Cellular component | cytosol Ref.1 Inferred from Experiment. Source: Reactome membrane fraction Ref.1Traceable author statement. Source: ProtInc mitochondrial outer membraneInferred from Experiment. Source: Reactome |
| Molecular function | death receptor binding Ref.1 Traceable author statement. Source: ProtInc |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| BAK1 | Q16611 | 1 | EBI-519672,EBI-519866 | |
| BCL2 | P10415 | 3 | EBI-519672,EBI-77694 | |
| BCL2A1 | Q16548 | 1 | EBI-519672,EBI-1003550 | |
| Bcl2a1 | Q07440 | 1 | EBI-519672,EBI-707754 | From a different organism. |
| BCL2L1 | Q07817 | 1 | EBI-519672,EBI-78035 | |
| BCL2L1 | Q07817-1 | 1 | EBI-519672,EBI-287195 | |
| BCL2L2 | Q92843 | 2 | EBI-519672,EBI-707714 | |
| MCL1 | Q07820 | 1 | EBI-519672,EBI-1003422 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P55957-1) Also known as: BID(L); This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P55957-2) Also known as: BID(EL); The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MCSGAGVMMARWAARGRAGWRSTVRILSPLGHCEPGVSRSCRAAQAM | ||||||
| Note: A significant proportion of isoform 2 localizes to mitochondria, it may be cleaved constitutively. Ref.3 | ||||||
| Isoform 3 (identifier: P55957-3) Also known as: BID(S); The sequence of this isoform differs from the canonical sequence as follows: 75-137: DSESQEDIIR...ATALEQLLQA → GASDNNTASA...AWTVASLRAW 138-195: Missing. | ||||||
| Isoform 4 (identifier: P55957-4) Also known as: BID(ES); The sequence of this isoform differs from the canonical sequence as follows: 1-96: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 195 | 195 | BH3-interacting domain death agonist | PRO_0000143101 | ||||||||||||||||||||||||
| Chain | 62 – 195 | 134 | BH3-interacting domain death agonist p15 By similarity | PRO_0000223233 | ||||||||||||||||||||||||
| Chain | 77 – 195 | 119 | BH3-interacting domain death agonist p13 By similarity | PRO_0000223232 | ||||||||||||||||||||||||
| Chain | 100 – 195 | 96 | BH3-interacting domain death agonist p11 By similarity | PRO_0000223231 | ||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||
| Motif | 86 – 100 | 15 | BH3 | |||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||
| Site | 61 – 62 | 2 | Cleavage By similarity | |||||||||||||||||||||||||
| Site | 76 – 77 | 2 | Cleavage By similarity | |||||||||||||||||||||||||
| Site | 99 – 100 | 2 | Cleavage By similarity | |||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||
| Modified residue | 54 | 1 | Phosphotyrosine Ref.9 | |||||||||||||||||||||||||
| Modified residue | 78 | 1 | Phosphoserine Ref.10 | |||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||
| Alternative sequence | 1 – 96 | 96 | Missing in isoform 4. | VSP_017266 | ||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MCSGAGVMMARWAARGRAGW RSTVRILSPLGHCEPGVSRS CRAAQAM in isoform 2. | VSP_017267 | ||||||||||||||||||||||||
| Alternative sequence | 75 – 137 | 63 | DSESQ…QLLQA → GASDNNTASAEEETEAAGSV AVERGLHGAATVILKVKKTS SGILPGTSPRSGTAWTVASL RAW in isoform 3. | VSP_017268 | ||||||||||||||||||||||||
| Alternative sequence | 138 – 195 | 58 | Missing in isoform 3. | VSP_017269 | ||||||||||||||||||||||||
| Natural variant | 10 | 1 | S → G: dbSNP rs8190315. Ref.7 | VAR_018845 | ||||||||||||||||||||||||
| Natural variant | 162 | 1 | H → Q: dbSNP rs17853595. Ref.8 | VAR_025332 | ||||||||||||||||||||||||
| Natural variant | 194 | 1 | M → T: dbSNP rs59225839. | VAR_061041 | ||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||
| Helix | 15 – 27 | 13 | ||||||||||||||||||||||||||
| Beta strand | 31 – 33 | 3 | ||||||||||||||||||||||||||
| Helix | 34 – 40 | 7 | ||||||||||||||||||||||||||
| Helix | 41 – 43 | 3 | ||||||||||||||||||||||||||
| Helix | 84 – 98 | 15 | ||||||||||||||||||||||||||
| Helix | 106 – 114 | 9 | ||||||||||||||||||||||||||
| Helix | 116 – 118 | 3 | ||||||||||||||||||||||||||
| Helix | 119 – 135 | 17 | ||||||||||||||||||||||||||
| Helix | 145 – 162 | 18 | ||||||||||||||||||||||||||
| Helix | 167 – 179 | 13 | ||||||||||||||||||||||||||
| Turn | 180 – 182 | 3 | ||||||||||||||||||||||||||
| Helix | 183 – 191 | 9 | ||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "BID: a novel BH3 domain-only death agonist." Wang K., Yin X.-M., Chao D.T., Milliman C.L., Korsmeyer S.J. Genes Dev. 10:2859-2869(1996) [PubMed: 8918887] [Abstract] Cited for: NUCLEOTIDE SEQUENCE (ISOFORM 1). |
| [2] | "The gene for death agonist BID maps to the region of human 22q11.2 duplicated in cat eye syndrome chromosomes and to mouse chromosome 6." Footz T.K., Birren B., Minoshima S., Asakawa S., Shimizu N., Riazi M.A., McDermid H.E. Genomics 51:472-475(1998) [PubMed: 9721221] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | "Three novel Bid proteins generated by alternative splicing of the human Bid gene." Renshaw S.A., Dempsey C.E., Barnes F.A., Bagstaff S.M., Dower S.K., Bingle C.D., Whyte M.K. J. Biol. Chem. 279:2846-2855(2004) [PubMed: 14583606] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, FUNCTION. |
| [4] | "Cloning and expression of a new human cDNA homology to murine apoptic death agonist (BID) mRNA." Dai F.Y., Yu L., Huang H.B., Jiang C.L., Cui Y.Y., Zhao S.Y. Submitted (JUL-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [5] | "A genome annotation-driven approach to cloning the human ORFeome." Collins J.E., Wright C.L., Edwards C.A., Davis M.P., Grinham J.A., Cole C.G., Goward M.E., Aguado B., Mallya M., Mokrab Y., Huckle E.J., Beare D.M., Dunham I. Genome Biol. 5:R84.1-R84.11(2004) [PubMed: 15461802] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [6] | "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. Submitted (MAY-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [7] | NIEHS SNPs program Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT GLY-10. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT GLN-162. Tissue: Brain and Skin. |
| [9] | "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells." Rush J., Moritz A., Lee K.A., Guo A., Goss V.L., Spek E.J., Zhang H., Zha X.-M., Polakiewicz R.D., Comb M.J. Nat. Biotechnol. 23:94-101(2005) [PubMed: 15592455] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-54, MASS SPECTROMETRY. |
| [10] | "ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage." Matsuoka S., Ballif B.A., Smogorzewska A., McDonald E.R. III, Hurov K.E., Luo J., Bakalarski C.E., Zhao Z., Solimini N., Lerenthal Y., Shiloh Y., Gygi S.P., Elledge S.J. Science 316:1160-1166(2007) [PubMed: 17525332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-78, MASS SPECTROMETRY. |
| [11] | Colinge J., Superti-Furga G., Bennett K.L. Submitted (OCT-2008) to UniProtKB Cited for: IDENTIFICATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. |
| [12] | "Solution structure of BID, an intracellular amplifier of apoptotic signaling." Chou J.J., Li H., Salvesen G.S., Yuan J., Wagner G. Cell 96:615-624(1999) [PubMed: 10089877] [Abstract] Cited for: STRUCTURE BY NMR. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF042083 mRNA. Translation: AAC34365.1. AF250233 mRNA. Translation: AAO32633.1. AY005151 mRNA. Translation: AAF89091.1. AF087891 mRNA. Translation: AAP97190.1. CR456389 mRNA. Translation: CAG30275.1. CR407603 mRNA. Translation: CAG28531.1. AY309922 Genomic DNA. Translation: AAP50259.1. BC009197 mRNA. Translation: AAH09197.1. BC022072 mRNA. Translation: AAH22072.2. Different initiation. BC033634 mRNA. Translation: AAH33634.1. BC036364 mRNA. Translation: AAH36364.2. | ||||||||||||||||||||||||
| IPI | IPI00385121. IPI00413587. IPI00420084. IPI00472003. | ||||||||||||||||||||||||
| RefSeq | NP_001187.1. NP_932070.1. NP_932071.1. | ||||||||||||||||||||||||
| UniGene | Hs.591054 | ||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||
| IntAct | P55957. 8 interactions. | ||||||||||||||||||||||||
| STRING | P55957. | ||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||
| PhosphoSite | P55957. | ||||||||||||||||||||||||
2-D gel databases | |||||||||||||||||||||||||
| OGP | P55957. | ||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||
| PRIDE | P55957. | ||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||
| Ensembl | ENST00000317361; ENSP00000318822; ENSG00000015475; Homo sapiens. [Genome view] ENST00000399774; ENSP00000382674; ENSG00000015475; Homo sapiens. [Genome view] | ||||||||||||||||||||||||
| GeneID | 637. | ||||||||||||||||||||||||
| KEGG | hsa:637. | ||||||||||||||||||||||||
| UCSC | uc002znd.1. human. uc002zne.1. human. | ||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||
| CTD | 637. | ||||||||||||||||||||||||
| GeneCards | GC22M016592. | ||||||||||||||||||||||||
| H-InvDB | HIX0016217. | ||||||||||||||||||||||||
| HGNC | HGNC:1050. BID. | ||||||||||||||||||||||||
| HPA | CAB003771. HPA000722. | ||||||||||||||||||||||||
| MIM | 601997. gene. | ||||||||||||||||||||||||
| PharmGKB | PA25353. | ||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||
| eggNOG | prNOG07914. | ||||||||||||||||||||||||
| HOVERGEN | P55957. | ||||||||||||||||||||||||
| InParanoid | P55957. | ||||||||||||||||||||||||
| OMA | DSEVSNG. | ||||||||||||||||||||||||
| OrthoDB | EOG9Z0DRX. | ||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||
| Pathway_Interaction_DB | caspase_pathway. Caspase cascade in apoptosis. ceramidepathway. Ceramide signaling pathway. faspathway. FAS signaling pathway (CD95). hivnefpathway. HIV-1 Nef: Negative effector of Fas and TNF-alpha. | ||||||||||||||||||||||||
| Reactome | REACT_578. Apoptosis. | ||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||
| ArrayExpress | P55957. | ||||||||||||||||||||||||
| Bgee | P55957. | ||||||||||||||||||||||||
| CleanEx | HS_BID. | ||||||||||||||||||||||||
| Genevestigator | P55957. | ||||||||||||||||||||||||
| GermOnline | ENSG00000015475. Homo sapiens. | ||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||
| InterPro | IPR020728. Bcl2_BH3_motif_CS. IPR010479. BID. [Graphical view] | ||||||||||||||||||||||||
| Pfam | PF06393. BID. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| PIRSF | PIRSF038018. BID. 1 hit. | ||||||||||||||||||||||||
| PROSITE | PS01259. BH3. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||
Other Resources | |||||||||||||||||||||||||
| NextBio | 2578. | ||||||||||||||||||||||||
| PMAP-CutDB | P55957. | ||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||
Entry information
| Entry name | BID_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P55957 Secondary accession number(s): Q549M7 Q8IY86 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 22 Human chromosome 22: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |

Clusters with


