P55884 (EIF3B_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 132.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Eukaryotic translation initiation factor 3 subunit B Short name=eIF3b Alternative name(s): Eukaryotic translation initiation factor 3 subunit 9 Prt1 homolog Short name=hPrt1 eIF-3-eta eIF3 p110 eIF3 p116 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 814 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S preinitiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. Ref.1 |
| Subunit structure | Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is composed of 13 subunits: EIF3A, EIF3B, EIF3C, EIF3D, EIF3E, EIF3F, EIF3G, EIF3H, EIF3I, EIF3J, EIF3K, EIF3L and EIF3M. The eIF-3 complex appears to include 3 stable modules: module A is composed of EIF3A, EIF3B, EIF3G and EIF3I; module B is composed of EIF3F, EIF3H, and EIF3M; and module C is composed of EIF3C, EIF3D, EIF3E, EIF3K and EIF3L. EIF3C of module C binds EIF3B of module A and EIF3H of module B, thereby linking the three modules. EIF3J is a labile subunit that binds to the eIF-3 complex via EIF3B. The eIF-3 complex interacts with RPS6KB1 under conditions of nutrient depletion. Mitogenic stimulation leads to binding and activation of a complex composed of MTOR and RPTOR, leading to phosphorylation and release of RPS6KB1 and binding of EIF4B to eIF-3. Also interacts with UPF2. Ref.7 Ref.8 Ref.9 Ref.10 Ref.11 Ref.14 Ref.16 Ref.17 Ref.20 Ref.27 |
| Subcellular location | Cytoplasm By similarity. |
| Domain | The RRM domain mediates interaction with EIF3J. HAMAP-Rule MF_03001 |
| Post-translational modification | Phosphorylated. Phosphorylation is enhanced upon serum stimulation. Ref.17 |
| Sequence similarities | Belongs to the eIF-3 subunit B family. Contains 1 RRM (RNA recognition motif) domain. Contains 5 WD repeats. |
| Mass spectrometry | Molecular mass is 93093.7 Da from positions 1 - 814. Ref.17 Molecular mass is 92561±43.5 Da from positions 1 - 814. Determined by MALDI. Ref.20 |
Ontologies
| Keywords | |
|---|---|
| Biological process | Protein biosynthesis |
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat WD repeat |
| Ligand | RNA-binding |
| Molecular function | Initiation factor |
| PTM | Acetylation Phosphoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | regulation of translational initiation Inferred from direct assay Ref.2. Source: UniProtKB |
| Cellular_component | cytosol Traceable author statement. Source: Reactome eukaryotic translation initiation factor 3 complexInferred from direct assay Ref.17Ref.15Ref.20Ref.2. Source: UniProtKB |
| Molecular_function | nucleotide binding Inferred from electronic annotation. Source: InterPro protein complex scaffoldTraceable author statement Ref.17. Source: UniProtKB translation initiation factor activityInferred from direct assay Ref.2. Source: UniProtKB |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| DDX3X | O00571 | 5 | EBI-366696,EBI-353779 | |
| EIF3A | Q14152 | 5 | EBI-366696,EBI-366617 | |
| EIF3G | O75821 | 4 | EBI-366696,EBI-366632 | |
| EIF3I | Q13347 | 4 | EBI-366696,EBI-354047 | |
| EIF3J | O75822 | 5 | EBI-366696,EBI-366647 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P55884-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P55884-2) The sequence of this isoform differs from the canonical sequence as follows: 812-814: NQE → IRSDLEHCAQPCVLWSRGRPAGSRVTPASSLCSLALDCDCAWILPLRHIFVPFSPWCLQWGI |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 814 | 814 | Eukaryotic translation initiation factor 3 subunit B HAMAP-Rule MF_03001 | PRO_0000123531 | ||||||||||||||||||||
Regions | ||||||||||||||||||||||||
| Domain | 185 – 268 | 84 | RRM | |||||||||||||||||||||
| Repeat | 332 – 370 | 39 | WD 1 HAMAP-Rule MF_03001 | |||||||||||||||||||||
| Repeat | 372 – 417 | 46 | WD 2 HAMAP-Rule MF_03001 | |||||||||||||||||||||
| Repeat | 421 – 459 | 39 | WD 3 HAMAP-Rule MF_03001 | |||||||||||||||||||||
| Repeat | 560 – 601 | 42 | WD 4 HAMAP-Rule MF_03001 | |||||||||||||||||||||
| Repeat | 649 – 694 | 46 | WD 5 HAMAP-Rule MF_03001 | |||||||||||||||||||||
| Region | 124 – 413 | 290 | Sufficient for interaction with EIF3E HAMAP-Rule MF_03001 | |||||||||||||||||||||
| Region | 170 – 274 | 105 | Sufficient for interaction with EIF3J HAMAP-Rule MF_03001 | |||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||
| Modified residue | 1 | 1 | N-acetylmethionine Ref.17 | |||||||||||||||||||||
| Modified residue | 78 | 1 | Phosphoserine Ref.19 | |||||||||||||||||||||
| Modified residue | 81 | 1 | Phosphoserine Ref.19 | |||||||||||||||||||||
| Modified residue | 83 | 1 | Phosphoserine Ref.17 Ref.19 | |||||||||||||||||||||
| Modified residue | 85 | 1 | Phosphoserine Ref.17 Ref.19 | |||||||||||||||||||||
| Modified residue | 119 | 1 | Phosphoserine Ref.17 | |||||||||||||||||||||
| Modified residue | 125 | 1 | Phosphoserine Ref.17 Ref.25 | |||||||||||||||||||||
| Modified residue | 152 | 1 | Phosphoserine Ref.13 Ref.17 Ref.21 Ref.23 | |||||||||||||||||||||
| Modified residue | 154 | 1 | Phosphoserine Ref.13 Ref.17 Ref.21 Ref.23 Ref.25 | |||||||||||||||||||||
| Modified residue | 164 | 1 | Phosphoserine Ref.13 Ref.17 Ref.21 Ref.23 | |||||||||||||||||||||
| Modified residue | 209 | 1 | N6-acetyllysine Ref.22 | |||||||||||||||||||||
| Modified residue | 239 | 1 | Phosphoserine Ref.19 Ref.23 | |||||||||||||||||||||
| Modified residue | 288 | 1 | N6-acetyllysine Ref.22 | |||||||||||||||||||||
| Modified residue | 364 | 1 | N6-acetyllysine Ref.22 | |||||||||||||||||||||
| Modified residue | 451 | 1 | Phosphothreonine By similarity | |||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||
| Alternative sequence | 812 – 814 | 3 | NQE → IRSDLEHCAQPCVLWSRGRP AGSRVTPASSLCSLALDCDC AWILPLRHIFVPFSPWCLQW GI in isoform 2. | VSP_017274 | ||||||||||||||||||||
| Natural variant | 64 | 1 | S → P. Ref.1 Ref.2 Ref.6 Corresponds to variant rs9690787 [ dbSNP | Ensembl ]. | VAR_047972 | ||||||||||||||||||||
| Natural variant | 793 | 1 | D → E. Corresponds to variant rs1063257 [ dbSNP | Ensembl ]. | VAR_047973 | ||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||
| Sequence conflict | 115 – 116 | 2 | ER → AG in AAB42010. Ref.2 | |||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||
| Beta strand | 186 – 191 | 6 | ||||||||||||||||||||||
| Turn | 197 – 199 | 3 | ||||||||||||||||||||||
| Helix | 200 – 212 | 13 | ||||||||||||||||||||||
| Beta strand | 217 – 221 | 5 | ||||||||||||||||||||||
| Beta strand | 232 – 239 | 8 | ||||||||||||||||||||||
| Helix | 240 – 247 | 8 | ||||||||||||||||||||||
| Beta strand | 250 – 252 | 3 | ||||||||||||||||||||||
| Beta strand | 256 – 259 | 4 | ||||||||||||||||||||||
| Beta strand | 260 – 264 | 5 | ||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Biochemical characterization of mammalian translation initiation factor 3 (eIF3). Molecular cloning reveals that p110 subunit is the mammalian homologue of Saccharomyces cerevisiae protein Prt1." Chaudhuri J., Chakrabarti A., Maitra U. J. Biol. Chem. 272:30975-30983(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, VARIANT PRO-64. Tissue: Skeletal muscle. |
| [2] | "The human homologue of the yeast Prt1 protein is an integral part of the eukaryotic initiation factor 3 complex and interacts with p170." Methot N., Rom E., Olsen H., Sonenberg N. J. Biol. Chem. 272:1110-1116(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), VARIANT PRO-64. Tissue: Placenta. |
| [3] | "The DNA sequence of human chromosome 7." Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. Wilson R.K.Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "Human chromosome 7: DNA sequence and biology." Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K., Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R., Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A., Kanematsu E., Gentles S. Tsui L.-C.Science 300:767-772(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT PRO-64. Tissue: Brain and Uterus. |
| [7] | "Saccharomyces cerevisiae protein Pci8p and human protein eIF3e/Int-6 interact with the eIF3 core complex by binding to cognate eIF3b subunits." Shalev A., Valasek L., Pise-Masison C.A., Radonovich M., Phan L., Clayton J., He H., Brady J.N., Hinnebusch A.G., Asano K. J. Biol. Chem. 276:34948-34957(2001) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH EIF3E. |
| [8] | "Molecular interaction between human tumor marker protein p150, the largest subunit of eIF3, and intermediate filament protein K7." Lin L., Holbro T., Alonso G., Gerosa D., Burger M.M. J. Cell. Biochem. 80:483-490(2001) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH EIF3A. |
| [9] | "Characterization of eIF3k: a newly discovered subunit of mammalian translation initiation factor eIF3." Mayeur G.L., Fraser C.S., Peiretti F., Block K.L., Hershey J.W.B. Eur. J. Biochem. 270:4133-4139(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH EIF3A; EIF3C; EIF3G; EIF3I AND EIF3K. |
| [10] | "The j-subunit of human translation initiation factor eIF3 is required for the stable binding of eIF3 and its subcomplexes to 40 S ribosomal subunits in vitro." Fraser C.S., Lee J.Y., Mayeur G.L., Bushell M., Doudna J.A., Hershey J.W.B. J. Biol. Chem. 279:8946-8956(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH EIF3A; EIF3G; EIF3I AND EIF3J. |
| [11] | "mTOR and S6K1 mediate assembly of the translation preinitiation complex through dynamic protein interchange and ordered phosphorylation events." Holz M.K., Ballif B.A., Gygi S.P., Blenis J. Cell 123:569-580(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH EIF4B; MTOR; RPTOR AND RPS6KB1. |
| [12] | "Binding of eukaryotic initiation factor 3 to ribosomal 40S subunits and its role in ribosomal dissociation and anti-association." Kolupaeva V.G., Unbehaun A., Lomakin I.B., Hellen C.U.T., Pestova T.V. RNA 11:470-486(2005) [PubMed] [Europe PMC] [Abstract] Cited for: CHARACTERIZATION OF THE EIF-3 COMPLEX. |
| [13] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-152; SER-154 AND SER-164, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [14] | "Translation initiation factor eIF4G-1 binds to eIF3 through the eIF3e subunit." LeFebvre A.K., Korneeva N.L., Trutschl M., Cvek U., Duzan R.D., Bradley C.A., Hershey J.W.B., Rhoads R.E. J. Biol. Chem. 281:22917-22932(2006) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION IN THE EIF-3 COMPLEX, IDENTIFICATION BY MASS SPECTROMETRY. |
| [15] | "Reconstitution reveals the functional core of mammalian eIF3." Masutani M., Sonenberg N., Yokoyama S., Imataka H. EMBO J. 26:3373-3383(2007) [PubMed] [Europe PMC] [Abstract] Cited for: CHARACTERIZATION OF THE EIF-3 COMPLEX. |
| [16] | "Human INT6/eIF3e is required for nonsense-mediated mRNA decay." Morris C., Wittmann J., Jaeck H.-M., Jalinot P. EMBO Rep. 8:596-602(2007) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH EIF3A; EIF3C; EIF3E AND UPF2. |
| [17] | "Structural characterization of the human eukaryotic initiation factor 3 protein complex by mass spectrometry." Damoc E., Fraser C.S., Zhou M., Videler H., Mayeur G.L., Hershey J.W.B., Doudna J.A., Robinson C.V., Leary J.A. Mol. Cell. Proteomics 6:1135-1146(2007) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION IN THE EIF-3 COMPLEX, CHARACTERIZATION OF THE EIF-3 COMPLEX, ACETYLATION AT MET-1, PHOSPHORYLATION AT SER-83; SER-85; SER-119; SER-125; SER-152; SER-154 AND SER-164, MASS SPECTROMETRY. |
| [18] | "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis." Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [19] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-78; SER-81; SER-83; SER-85 AND SER-239, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [20] | "Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3." Zhou M., Sandercock A.M., Fraser C.S., Ridlova G., Stephens E., Schenauer M.R., Yokoi-Fong T., Barsky D., Leary J.A., Hershey J.W.B., Doudna J.A., Robinson C.V. Proc. Natl. Acad. Sci. U.S.A. 105:18139-18144(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION IN THE EIF-3 COMPLEX, CHARACTERIZATION OF THE EIF-3 COMPLEX, INTERACTION WITH EIF3E; EIF3F; EIF3H; EIF3L AND EIF3M, MASS SPECTROMETRY. |
| [21] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-152; SER-154 AND SER-164, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [22] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-209; LYS-288 AND LYS-364, MASS SPECTROMETRY. |
| [23] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-152; SER-154; SER-164 AND SER-239, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [24] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [25] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-125 AND SER-154, MASS SPECTROMETRY. |
| [26] | "Structural roles for human translation factor eIF3 in initiation of protein synthesis." Siridechadilok B., Fraser C.S., Hall R.J., Doudna J.A., Nogales E. Science 310:1513-1515(2005) [PubMed] [Europe PMC] [Abstract] Cited for: 3D-STRUCTURE MODELING, ELECTRON MICROSCOPY. |
| [27] | "Structure of eIF3b RNA recognition motif and its interaction with eIF3j: structural insights into the recruitment of eIF3b to the 40 S ribosomal subunit." ElAntak L., Tzakos A.G., Locker N., Lukavsky P.J. J. Biol. Chem. 282:8165-8174(2007) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 170-274, INTERACTION WITH EIF3J. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U78525 mRNA. Translation: AAC99479.1. U62583 mRNA. Translation: AAB42010.1. AC004971 Genomic DNA. No translation available. AC004840 Genomic DNA. No translation available. CH236953 Genomic DNA. Translation: EAL23951.1. CH471144 Genomic DNA. Translation: EAW87237.1. BC001173 mRNA. Translation: AAH01173.1. BC110865 mRNA. Translation: AAI10866.1. | ||||||||||||||||||
| IPI | IPI00396370. IPI00719752. | ||||||||||||||||||
| PIR | T09582. | ||||||||||||||||||
| RefSeq | NP_001032360.1. NM_001037283.1. NP_003742.2. NM_003751.3. | ||||||||||||||||||
| UniGene | Hs.371001. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | P55884. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| DIP | DIP-31113N. | ||||||||||||||||||
| IntAct | P55884. 29 interactions. | ||||||||||||||||||
| MINT | MINT-4999648. | ||||||||||||||||||
| STRING | 9606.ENSP00000354125. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | P55884. | ||||||||||||||||||
Polymorphism databases | |||||||||||||||||||
| DMDM | 218512094. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PaxDb | P55884. | ||||||||||||||||||
| PRIDE | P55884. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000360876; ENSP00000354125; ENSG00000106263. ENST00000397011; ENSP00000380206; ENSG00000106263. | ||||||||||||||||||
| GeneID | 8662. | ||||||||||||||||||
| KEGG | hsa:8662. | ||||||||||||||||||
| UCSC | uc003slx.3. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 8662. | ||||||||||||||||||
| GeneCards | GC07P002362. | ||||||||||||||||||
| H-InvDB | HIX0006430. | ||||||||||||||||||
| HGNC | HGNC:3280. EIF3B. | ||||||||||||||||||
| HPA | CAB017562. | ||||||||||||||||||
| MIM | 603917. gene. | ||||||||||||||||||
| neXtProt | NX_P55884. | ||||||||||||||||||
| PharmGKB | PA162384603. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | COG5354. | ||||||||||||||||||
| HOGENOM | HOG000265546. | ||||||||||||||||||
| HOVERGEN | HBG006127. | ||||||||||||||||||
| KO | K03253. | ||||||||||||||||||
| OrthoDB | EOG42JNQZ. | ||||||||||||||||||
| PhylomeDB | P55884. | ||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||
| Reactome | REACT_17015. Metabolism of proteins. REACT_1762. 3' -UTR-mediated translational regulation. REACT_71. Gene Expression. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | P55884. | ||||||||||||||||||
| Bgee | P55884. | ||||||||||||||||||
| CleanEx | HS_EIF3B. | ||||||||||||||||||
| Genevestigator | P55884. | ||||||||||||||||||
| GermOnline | ENSG00000106263. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| Gene3D | 2.130.10.10. 2 hits. 3.30.70.330. 1 hit. | ||||||||||||||||||
| HAMAP | MF_03001. eIF3b. | ||||||||||||||||||
| InterPro | IPR011400. eIF3b. IPR012677. Nucleotide-bd_a/b_plait. IPR000504. RRM_dom. IPR013979. TIF2A_beta_prop-like. IPR015943. WD40/YVTN_repeat-like_dom. [Graphical view] | ||||||||||||||||||
| PANTHER | PTHR14068. PTHR14068. 1 hit. | ||||||||||||||||||
| Pfam | PF08662. eIF2A. 1 hit. PF00076. RRM_1. 1 hit. [Graphical view] | ||||||||||||||||||
| PIRSF | PIRSF036424. eIF3b. 1 hit. | ||||||||||||||||||
| SMART | SM00360. RRM. 1 hit. [Graphical view] | ||||||||||||||||||
| PROSITE | PS50102. RRM. 1 hit. PS00678. WD_REPEATS_1. False negative. PS50082. WD_REPEATS_2. False negative. PS50294. WD_REPEATS_REGION. False negative. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| ChiTaRS | EIF3B. human. | ||||||||||||||||||
| EvolutionaryTrace | P55884. | ||||||||||||||||||
| GenomeRNAi | 8662. | ||||||||||||||||||
| NextBio | 32487. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | EIF3B_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P55884 Secondary accession number(s): A4D208, Q2NL77, Q9UMF9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Translation initiation factors List of translation initiation factor entries |
| Human chromosome 7 Human chromosome 7: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
