Reviewed,
UniProtKB/Swiss-Prot P55884 (EIF3B_HUMAN)
Last modified
June 16, 2009.
Version 91.
History...
Clusters with 100%,
90%,
50% identity |
Documents (7) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Eukaryotic translation initiation factor 3 subunit B Short name=eIF3b Alternative name(s): Eukaryotic translation initiation factor 3 subunit 9 eIF-3-eta eIF3 p116 eIF3 p110 Prt1 homolog Short name=hPrt1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 814 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S preinitiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of posttermination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. Ref.1 |
| Subunit structure | Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is composed of 13 subunits: EIF3A, EIF3B, EIF3C, EIF3D, EIF3E, EIF3F, EIF3G, EIF3H, EIF3I, EIF3J, EIF3K, EIF3L and EIF3M. The eIF-3 complex appears to include 3 stable modules: module A is composed of EIF3A, EIF3B, EIF3G and EIF3I; module B is composed of EIF3F, EIF3H, and EIF3M; and module C is composed of EIF3C, EIF3D, EIF3E, EIF3K and EIF3L. EIF3C of module C binds EIF3B of module A and EIF3H of module B, thereby linking the three modules. EIF3J is a labile subunit that binds to the eIF-3 complex via EIF3B. The eIF-3 complex interacts with RPS6KB1 under conditions of nutrient depletion. Mitogenic stimulation leads to binding and activation of a complex composed of FRAP1 and RAPTOR, leading to phosphorylation and release of RPS6KB1 and binding of EIF4B to eIF-3. Also interacts with UPF2. Ref.7 Ref.8 Ref.9 Ref.10 Ref.12 Ref.18 Ref.22 Ref.25 |
| Subcellular location | Cytoplasm Probable. |
| Domain | The RRM domain mediates interaction with EIF3J. |
| Post-translational modification | Phosphorylated. Phosphorylation is enhanced upon serum stimulation. Ref.11 Ref.13 Ref.15 Ref.19 Ref.20 Ref.21 |
| Sequence similarities | Belongs to the eIF-3 subunit B family. Contains 1 RRM (RNA recognition motif) domain. Contains 5 WD repeats. |
| Mass spectrometry | Molecular mass is 93093.7 Da from positions 1 - 814. Ref.19 Molecular mass is 92561±43.5 Da from positions 1 - 814. Determined by MALDI. Ref.22 |
Ontologies
| Keywords | |
|---|---|
| Biological process | Protein biosynthesis |
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat WD repeat |
| Ligand | RNA-binding |
| Molecular function | Initiation factor |
| PTM | Acetylation Phosphoprotein |
| Technical term | 3D-structure |
| Gene Ontology (GO) | |
| Biological process | regulation of translational initiation Ref.2 Inferred from direct assay. Source: UniProtKB translational initiation Ref.2Inferred from direct assay. Source: UniProtKB |
| Cellular component | cytosol Inferred from Experiment. Source: Reactome eukaryotic translation initiation factor 3 complex Ref.2Inferred from direct assay. Source: UniProtKB |
| Molecular function | RNA binding Inferred from electronic annotation. Source: UniProtKB-KW nucleotide bindingInferred from electronic annotation. Source: InterPro protein binding Ref.8 Ref.10Inferred from physical interaction. Source: IntAct translation initiation factor activity Ref.2Inferred from direct assay. Source: UniProtKB |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| EIF3A | Q14152 | 2 | EBI-366696,EBI-366617 | |
| EIF3G | O75821 | 1 | EBI-366696,EBI-366632 | |
| EIF3I | Q13347 | 1 | EBI-366696,EBI-354047 | |
| EIF3J | O75822 | 1 | EBI-366696,EBI-366647 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P55884-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P55884-2) The sequence of this isoform differs from the canonical sequence as follows: 812-814: NQE → IRSDLEHCAQPCVLWSRGRPAGSRVTPASSLCSLALDCDCAWILPLRHIFVPFSPWCLQWGI |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 814 | 814 | Eukaryotic translation initiation factor 3 subunit B | PRO_0000123531 | ||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||
| Domain | 185 – 268 | 84 | RRM | |||||||||||||||||||||||
| Repeat | 332 – 370 | 39 | WD 1 | |||||||||||||||||||||||
| Repeat | 372 – 417 | 46 | WD 2 | |||||||||||||||||||||||
| Repeat | 421 – 459 | 39 | WD 3 | |||||||||||||||||||||||
| Repeat | 560 – 601 | 42 | WD 4 | |||||||||||||||||||||||
| Repeat | 649 – 694 | 46 | WD 5 | |||||||||||||||||||||||
| Region | 124 – 413 | 290 | Sufficient for interaction with EIF3E | |||||||||||||||||||||||
| Region | 170 – 274 | 105 | Sufficient for interaction with EIF3J | |||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||
| Modified residue | 1 | 1 | N-acetylmethionine | |||||||||||||||||||||||
| Modified residue | 78 | 1 | Phosphoserine Ref.21 | |||||||||||||||||||||||
| Modified residue | 81 | 1 | Phosphoserine Ref.21 | |||||||||||||||||||||||
| Modified residue | 83 | 1 | Phosphoserine Ref.11 Ref.19 Ref.20 Ref.21 | |||||||||||||||||||||||
| Modified residue | 85 | 1 | Phosphoserine Ref.11 Ref.19 Ref.21 | |||||||||||||||||||||||
| Modified residue | 119 | 1 | Phosphoserine Ref.19 | |||||||||||||||||||||||
| Modified residue | 125 | 1 | Phosphoserine Ref.11 Ref.19 Ref.21 | |||||||||||||||||||||||
| Modified residue | 152 | 1 | Phosphoserine Ref.15 Ref.19 | |||||||||||||||||||||||
| Modified residue | 154 | 1 | Phosphoserine Ref.15 Ref.19 | |||||||||||||||||||||||
| Modified residue | 164 | 1 | Phosphoserine Ref.15 Ref.19 | |||||||||||||||||||||||
| Modified residue | 239 | 1 | Phosphoserine Ref.21 | |||||||||||||||||||||||
| Modified residue | 451 | 1 | Phosphothreonine By similarity | |||||||||||||||||||||||
| Modified residue | 525 | 1 | Phosphotyrosine Ref.13 | |||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||
| Alternative sequence | 812 – 814 | 3 | NQE → IRSDLEHCAQPCVLWSRGRP AGSRVTPASSLCSLALDCDC AWILPLRHIFVPFSPWCLQW GI in isoform 2. | VSP_017274 | ||||||||||||||||||||||
| Natural variant | 64 | 1 | S → P: dbSNP rs9690787. Ref.1 Ref.2 Ref.6 | VAR_047972 | ||||||||||||||||||||||
| Natural variant | 793 | 1 | D → E: dbSNP rs1063257. | VAR_047973 | ||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||
| Sequence conflict | 115 – 116 | 2 | ER → AG in AAB42010. Ref.2 | |||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||
| Beta strand | 185 – 191 | 7 | ||||||||||||||||||||||||
| Turn | 197 – 201 | 5 | ||||||||||||||||||||||||
| Helix | 202 – 211 | 10 | ||||||||||||||||||||||||
| Helix | 212 – 214 | 3 | ||||||||||||||||||||||||
| Beta strand | 217 – 221 | 5 | ||||||||||||||||||||||||
| Beta strand | 232 – 237 | 6 | ||||||||||||||||||||||||
| Beta strand | 239 – 241 | 3 | ||||||||||||||||||||||||
| Helix | 242 – 249 | 8 | ||||||||||||||||||||||||
| Beta strand | 251 – 254 | 4 | ||||||||||||||||||||||||
| Beta strand | 260 – 264 | 5 | ||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Biochemical characterization of mammalian translation initiation factor 3 (eIF3). Molecular cloning reveals that p110 subunit is the mammalian homologue of Saccharomyces cerevisiae protein Prt1." Chaudhuri J., Chakrabarti A., Maitra U. J. Biol. Chem. 272:30975-30983(1997) [PubMed: 9388245] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, VARIANT PRO-64. Tissue: Skeletal muscle. |
| [2] | "The human homologue of the yeast Prt1 protein is an integral part of the eukaryotic initiation factor 3 complex and interacts with p170." Methot N., Rom E., Olsen H., Sonenberg N. J. Biol. Chem. 272:1110-1116(1997) [PubMed: 8995410] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), VARIANT PRO-64. Tissue: Placenta. |
| [3] | "The DNA sequence of human chromosome 7." Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. Wilson R.K.Nature 424:157-164(2003) [PubMed: 12853948] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "Human chromosome 7: DNA sequence and biology." Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K., Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R., Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A., Kanematsu E., Gentles S. Tsui L.-C.Science 300:767-772(2003) [PubMed: 12690205] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT PRO-64. Tissue: Brain and Uterus. |
| [7] | "Saccharomyces cerevisiae protein Pci8p and human protein eIF3e/Int-6 interact with the eIF3 core complex by binding to cognate eIF3b subunits." Shalev A., Valasek L., Pise-Masison C.A., Radonovich M., Phan L., Clayton J., He H., Brady J.N., Hinnebusch A.G., Asano K. J. Biol. Chem. 276:34948-34957(2001) [PubMed: 11457827] [Abstract] Cited for: INTERACTION WITH EIF3E. |
| [8] | "Molecular interaction between human tumor marker protein p150, the largest subunit of eIF3, and intermediate filament protein K7." Lin L., Holbro T., Alonso G., Gerosa D., Burger M.M. J. Cell. Biochem. 80:483-490(2001) [PubMed: 11169732] [Abstract] Cited for: INTERACTION WITH EIF3A. |
| [9] | "Characterization of eIF3k: a newly discovered subunit of mammalian translation initiation factor eIF3." Mayeur G.L., Fraser C.S., Peiretti F., Block K.L., Hershey J.W.B. Eur. J. Biochem. 270:4133-4139(2003) [PubMed: 14519125] [Abstract] Cited for: INTERACTION WITH EIF3A; EIF3C; EIF3G; EIF3I AND EIF3K. |
| [10] | "The j-subunit of human translation initiation factor eIF3 is required for the stable binding of eIF3 and its subcomplexes to 40 S ribosomal subunits in vitro." Fraser C.S., Lee J.Y., Mayeur G.L., Bushell M., Doudna J.A., Hershey J.W.B. J. Biol. Chem. 279:8946-8956(2004) [PubMed: 14688252] [Abstract] Cited for: INTERACTION WITH EIF3A; EIF3G; EIF3I AND EIF3J. |
| [11] | "Large-scale characterization of HeLa cell nuclear phosphoproteins." Beausoleil S.A., Jedrychowski M., Schwartz D., Elias J.E., Villen J., Li J., Cohn M.A., Cantley L.C., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 101:12130-12135(2004) [PubMed: 15302935] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-83; SER-85 AND SER-125, MASS SPECTROMETRY. Tissue: Epithelium. |
| [12] | "mTOR and S6K1 mediate assembly of the translation preinitiation complex through dynamic protein interchange and ordered phosphorylation events." Holz M.K., Ballif B.A., Gygi S.P., Blenis J. Cell 123:569-580(2005) [PubMed: 16286006] [Abstract] Cited for: INTERACTION WITH EIF4B; FRAP1; RAPTOR AND RPS6KB1. |
| [13] | "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells." Rush J., Moritz A., Lee K.A., Guo A., Goss V.L., Spek E.J., Zhang H., Zha X.-M., Polakiewicz R.D., Comb M.J. Nat. Biotechnol. 23:94-101(2005) [PubMed: 15592455] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-525, MASS SPECTROMETRY. |
| [14] | "Binding of eukaryotic initiation factor 3 to ribosomal 40S subunits and its role in ribosomal dissociation and anti-association." Kolupaeva V.G., Unbehaun A., Lomakin I.B., Hellen C.U.T., Pestova T.V. RNA 11:470-486(2005) [PubMed: 15703437] [Abstract] Cited for: CHARACTERIZATION OF THE EIF-3 COMPLEX. |
| [15] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed: 17081983] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-152; SER-154 AND SER-164, MASS SPECTROMETRY. Tissue: Epithelium. |
| [16] | "Translation initiation factor eIF4G-1 binds to eIF3 through the eIF3e subunit." LeFebvre A.K., Korneeva N.L., Trutschl M., Cvek U., Duzan R.D., Bradley C.A., Hershey J.W.B., Rhoads R.E. J. Biol. Chem. 281:22917-22932(2006) [PubMed: 16766523] [Abstract] Cited for: IDENTIFICATION IN THE EIF-3 COMPLEX, IDENTIFICATION BY MASS SPECTROMETRY. |
| [17] | "Reconstitution reveals the functional core of mammalian eIF3." Masutani M., Sonenberg N., Yokoyama S., Imataka H. EMBO J. 26:3373-3383(2007) [PubMed: 17581632] [Abstract] Cited for: CHARACTERIZATION OF THE EIF-3 COMPLEX. |
| [18] | "Human INT6/eIF3e is required for nonsense-mediated mRNA decay." Morris C., Wittmann J., Jaeck H.-M., Jalinot P. EMBO Rep. 8:596-602(2007) [PubMed: 17468741] [Abstract] Cited for: INTERACTION WITH EIF3A; EIF3C; EIF3E AND UPF2. |
| [19] | "Structural characterization of the human eukaryotic initiation factor 3 protein complex by mass spectrometry." Damoc E., Fraser C.S., Zhou M., Videler H., Mayeur G.L., Hershey J.W.B., Doudna J.A., Robinson C.V., Leary J.A. Mol. Cell. Proteomics 6:1135-1146(2007) [PubMed: 17322308] [Abstract] Cited for: IDENTIFICATION IN THE EIF-3 COMPLEX, CHARACTERIZATION OF THE EIF-3 COMPLEX, ACETYLATION, PHOSPHORYLATION AT SER-83; SER-85; SER-119; SER-125; SER-152; SER-154 AND SER-164, MASS SPECTROMETRY. |
| [20] | "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis." Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III J. Proteome Res. 7:1346-1351(2008) [PubMed: 18220336] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-83, MASS SPECTROMETRY. |
| [21] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-78; SER-81; SER-83; SER-85; SER-125 AND SER-239, MASS SPECTROMETRY. |
| [22] | "Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3." Zhou M., Sandercock A.M., Fraser C.S., Ridlova G., Stephens E., Schenauer M.R., Yokoi-Fong T., Barsky D., Leary J.A., Hershey J.W.B., Doudna J.A., Robinson C.V. Proc. Natl. Acad. Sci. U.S.A. 105:18139-18144(2008) [PubMed: 18599441] [Abstract] Cited for: IDENTIFICATION IN THE EIF-3 COMPLEX, CHARACTERIZATION OF THE EIF-3 COMPLEX, INTERACTION WITH EIF3E; EIF3F; EIF3H; EIF3L AND EIF3M, MASS SPECTROMETRY. |
| [23] | Colinge J., Superti-Furga G., Bennett K.L. Submitted (OCT-2008) to UniProtKB Cited for: IDENTIFICATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. |
| [24] | "Structural roles for human translation factor eIF3 in initiation of protein synthesis." Siridechadilok B., Fraser C.S., Hall R.J., Doudna J.A., Nogales E. Science 310:1513-1515(2005) [PubMed: 16322461] [Abstract] Cited for: 3D-STRUCTURE MODELING, ELECTRON MICROSCOPY. |
| [25] | "Structure of eIF3b RNA recognition motif and its interaction with eIF3j: structural insights into the recruitment of eIF3b to the 40 S ribosomal subunit." ElAntak L., Tzakos A.G., Locker N., Lukavsky P.J. J. Biol. Chem. 282:8165-8174(2007) [PubMed: 17190833] [Abstract] Cited for: STRUCTURE BY NMR OF 170-274, INTERACTION WITH EIF3J. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| U78525 mRNA. Translation: AAC99479.1. U62583 mRNA. Translation: AAB42010.1. AC004971 Genomic DNA. No translation available. AC004840 Genomic DNA. No translation available. CH236953 Genomic DNA. Translation: EAL23951.1. CH471144 Genomic DNA. Translation: EAW87237.1. BC001173 mRNA. Translation: AAH01173.1. BC110865 mRNA. Translation: AAI10866.1. | |||||||||||||
| IPI | IPI00396370. IPI00719752. | ||||||||||||
| PIR | T09582. | ||||||||||||
| RefSeq | NP_001032360.1. NP_003742.2. | ||||||||||||
| UniGene | Hs.371001 | ||||||||||||
3D structure databases | |||||||||||||
| |||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | P55884. 10 interactions. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | P55884. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | P55884. | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENSG00000106263. Homo sapiens. [Contig view] | ||||||||||||
| GeneID | 8662. | ||||||||||||
| KEGG | hsa:8662. | ||||||||||||
Organism-specific databases | |||||||||||||
| GeneCards | GC07P002362. | ||||||||||||
| H-InvDB | HIX0006430. | ||||||||||||
| HGNC | HGNC:3280. EIF3B. | ||||||||||||
| HPA | CAB017562. | ||||||||||||
| MIM | 603917. gene. | ||||||||||||
| PharmGKB | PA27709. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| HOVERGEN | P55884. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Reactome | REACT_1762. 3' -UTR-mediated translational regulation. REACT_71. Gene Expression. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | P55884. | ||||||||||||
| Bgee | P55884. | ||||||||||||
| CleanEx | HS_EIF3B. | ||||||||||||
| GermOnline | ENSG00000106263. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR012677. a_b_plait_nuc_bd. IPR013979. eIF2A_central-region. IPR011400. eIF3b. IPR000504. RRM_RNP1. IPR015943. WD40/YVTN_repeat-like. IPR019775. WD40_repeat_CS. [Graphical view] | ||||||||||||
| Gene3D | G3DSA:3.30.70.330. a_b_plait_nuc_bd. 1 hit. G3DSA:2.130.10.10. WD40/YVTN_repeat-like. 1 hit. | ||||||||||||
| PANTHER | PTHR14068. eIF3b. 1 hit. | ||||||||||||
| Pfam | PF08662. eIF2A. 1 hit. PF00076. RRM_1. 1 hit. [Graphical view] | ||||||||||||
| PIRSF | PIRSF036424. eIF3b. 1 hit. | ||||||||||||
| SMART | SM00360. RRM. 1 hit. [Graphical view] | ||||||||||||
| PROSITE | PS50102. RRM. 1 hit. PS00678. WD_REPEATS_1. False negative. PS50082. WD_REPEATS_2. False negative. PS50294. WD_REPEATS_REGION. False negative. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other Resources | |||||||||||||
| NextBio | 32487. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | EIF3B_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P55884 Secondary accession number(s): A4D208, Q2NL77, Q9UMF9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 7 Human chromosome 7: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| Translation initiation factors List of translation initiation factor entries |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


