Reviewed,
UniProtKB/Swiss-Prot P55884 (EIF3B_HUMAN)
Last modified
November 25, 2008.
Version 84.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Eukaryotic translation initiation factor 3 subunit B Short name=eIF3b Alternative name(s): Eukaryotic translation initiation factor 3 subunit 9 eIF-3-eta eIF3 p116 eIF3 p110 Prt1 homolog Short name=hPrt1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 814 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Binds to the 40S ribosome and promotes the binding of methionyl-tRNAi and mRNA. |
| Subunit structure | eIF-3 is composed of at least 13 different subunits. Interacts with EIF3A. |
| Sequence similarities | Belongs to the eIF-3 subunit B family. Contains 1 RRM (RNA recognition motif) domain. |
Ontologies
Keywords | |
|---|---|
| Biological process | Protein biosynthesis |
| Coding sequence diversity | Alternative splicing |
| Ligand | RNA-binding |
| Molecular function | Initiation factor |
| PTM | Phosphoprotein |
| Technical term | 3D-structure |
Gene Ontology (GO) | |
| Biological process | translational initiation Ref.2 Traceable author statement. Source: ProtInc |
| Cellular component | cytosol Inferred from Experiment. Source: Reactome eukaryotic translation initiation factor 3 complex Ref.2Traceable author statement. Source: ProtInc |
| Molecular function | RNA binding Inferred from electronic annotation. Source: InterPro nucleotide bindingInferred from electronic annotation. Source: InterPro protein binding Ref.4Inferred from physical interaction. Source: IntAct translation initiation factor activity Ref.2Traceable author statement. Source: ProtInc |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| EIF3A | Q14152 | 2 | EBI-366696,EBI-366617 | |
| EIF3G | O75821 | 1 | EBI-366696,EBI-366632 | |
| EIF3I | Q13347 | 1 | EBI-366696,EBI-354047 | |
| EIF3J | O75822 | 1 | EBI-366696,EBI-366647 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P55884-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P55884-2) The sequence of this isoform differs from the canonical sequence as follows: 812-814: NQE → IRSDLEHCAQPCVLWSRGRPAGSRVTPASSLCSLALDCDCAWILPLRHIFVPFSPWCLQWGI |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 814 | 814 | Eukaryotic translation initiation factor 3 subunit B | PRO_0000123531 | ||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||
| Domain | 185 – 268 | 84 | RRM | |||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||
| Modified residue | 78 | 1 | Phosphoserine | |||||||||||||||||||||||
| Modified residue | 81 | 1 | Phosphoserine | |||||||||||||||||||||||
| Modified residue | 83 | 1 | Phosphoserine | |||||||||||||||||||||||
| Modified residue | 85 | 1 | Phosphoserine | |||||||||||||||||||||||
| Modified residue | 125 | 1 | Phosphoserine | |||||||||||||||||||||||
| Modified residue | 152 | 1 | Phosphoserine | |||||||||||||||||||||||
| Modified residue | 154 | 1 | Phosphoserine | |||||||||||||||||||||||
| Modified residue | 164 | 1 | Phosphoserine | |||||||||||||||||||||||
| Modified residue | 239 | 1 | Phosphoserine | |||||||||||||||||||||||
| Modified residue | 451 | 1 | Phosphothreonine By similarity | |||||||||||||||||||||||
| Modified residue | 525 | 1 | Phosphotyrosine | |||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||
| Alternative sequence | 812 – 814 | 3 | NQE → IRSDLEHCAQPCVLWSRGRP AGSRVTPASSLCSLALDCDC AWILPLRHIFVPFSPWCLQW GI in isoform 2. | VSP_017274 | ||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||
| Sequence conflict | 115 – 116 | 2 | ER → AG in AAB42010. Ref.2 | |||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||
| Beta strand | 185 – 191 | 7 | ||||||||||||||||||||||||
| Turn | 197 – 201 | 5 | ||||||||||||||||||||||||
| Helix | 202 – 211 | 10 | ||||||||||||||||||||||||
| Helix | 212 – 214 | 3 | ||||||||||||||||||||||||
| Beta strand | 217 – 221 | 5 | ||||||||||||||||||||||||
| Beta strand | 232 – 237 | 6 | ||||||||||||||||||||||||
| Beta strand | 239 – 241 | 3 | ||||||||||||||||||||||||
| Helix | 242 – 249 | 8 | ||||||||||||||||||||||||
| Beta strand | 251 – 254 | 4 | ||||||||||||||||||||||||
| Beta strand | 260 – 264 | 5 | ||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Biochemical characterization of mammalian translation initiation factor 3 (eIF3). Molecular cloning reveals that p110 subunit is the mammalian homologue of Saccharomyces cerevisiae protein Prt1." Chaudhuri J., Chakrabarti A., Maitra U. J. Biol. Chem. 272:30975-30983(1997) [PubMed: 9388245] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION. Tissue: Skeletal muscle. |
| [2] | "The human homologue of the yeast Prt1 protein is an integral part of the eukaryotic initiation factor 3 complex and interacts with p170." Methot N., Rom E., Olsen H., Sonenberg N. J. Biol. Chem. 272:1110-1116(1997) [PubMed: 8995410] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Tissue: Placenta. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain and Uterus. |
| [4] | "Molecular interaction between human tumor marker protein p150, the largest subunit of eIF3, and intermediate filament protein K7." Lin L., Holbro T., Alonso G., Gerosa D., Burger M.M. J. Cell. Biochem. 80:483-490(2001) [PubMed: 11169732] [Abstract] Cited for: INTERACTION WITH EIF3A. |
| [5] | "Large-scale characterization of HeLa cell nuclear phosphoproteins." Beausoleil S.A., Jedrychowski M., Schwartz D., Elias J.E., Villen J., Li J., Cohn M.A., Cantley L.C., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 101:12130-12135(2004) [PubMed: 15302935] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-83; SER-85 AND SER-125, MASS SPECTROMETRY. Tissue: Epithelium. |
| [6] | "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells." Rush J., Moritz A., Lee K.A., Guo A., Goss V.L., Spek E.J., Zhang H., Zha X.-M., Polakiewicz R.D., Comb M.J. Nat. Biotechnol. 23:94-101(2005) [PubMed: 15592455] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-525, MASS SPECTROMETRY. |
| [7] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed: 17081983] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-152; SER-154 AND SER-164, MASS SPECTROMETRY. Tissue: Epithelium. |
| [8] | "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis." Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III J. Proteome Res. 7:1346-1351(2008) [PubMed: 18220336] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-83, MASS SPECTROMETRY. |
| [9] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-78; SER-81; SER-83; SER-85; SER-125 AND SER-239, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| U78525 mRNA. Translation: AAC99479.1. U62583 mRNA. Translation: AAB42010.1. BC001173 mRNA. Translation: AAH01173.1. BC110865 mRNA. Translation: AAI10866.1. | |||||||||||||
| PIR | T09582. | ||||||||||||
| RefSeq | NP_001032360.1. NP_003742.2. | ||||||||||||
| UniGene | Hs.371001 | ||||||||||||
3D structure databases | |||||||||||||
| |||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | P55884. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | P55884. | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENSG00000106263. Homo sapiens. [Contig view] | ||||||||||||
| GeneID | 8662. | ||||||||||||
| KEGG | hsa:8662. | ||||||||||||
Organism-specific databases | |||||||||||||
| H-InvDB | HIX0006430. | ||||||||||||
| HGNC | HGNC:3280. EIF3B. | ||||||||||||
| HPA | CAB017562. | ||||||||||||
| MIM | 603917. gene. | ||||||||||||
| PharmGKB | PA27709. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
| GeneCards | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| HOVERGEN | P55884. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Reactome | REACT_1762. 3' -UTR-mediated translational regulation. REACT_71. Gene Expression. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | P55884. | ||||||||||||
| CleanEx | HS_EIF3B. | ||||||||||||
| GermOnline | ENSG00000106263. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR012677. a_b_plait_nuc_bd. IPR013979. eIF2A_central-region. IPR011400. eIF3b. IPR000504. RRM_RNP1. IPR015943. WD40/YVTN_repeat-like. [Graphical view] | ||||||||||||
| Gene3D | G3DSA:3.30.70.330. a_b_plait_nuc_bd. 1 hit. G3DSA:2.130.10.10. WD40/YVTN_repeat-like. 1 hit. | ||||||||||||
| PANTHER | PTHR14068. eIF3b. 1 hit. | ||||||||||||
| Pfam | PF08662. eIF2A. 1 hit. PF00076. RRM_1. 1 hit. [Graphical view] | ||||||||||||
| PIRSF | PIRSF036424. eIF3b. 1 hit. | ||||||||||||
| SMART | SM00360. RRM. 1 hit. [Graphical view] | ||||||||||||
| PROSITE | PS50102. RRM. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other Resources | |||||||||||||
| NextBio | 32487. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | EIF3B_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P55884 Secondary accession number(s): Q2NL77, Q9UMF9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 7 Human chromosome 7: entries, gene names and cross-references to MIM |
| Translation initiation factors List of translation initiation factor entries |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


