SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P55735

- SEC13_HUMAN

UniProt

P55735 - SEC13_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Protein SEC13 homolog
Gene
SEC13, D3S1231E, SEC13L1, SEC13R
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Functions as a component of the nuclear pore complex (NPC) and the COPII coat. At the endoplasmic reticulum, SEC13 is involved in the biogenesis of COPII-coated vesicles. As a component of the GATOR2 complex, inhibits GATOR1 complex, an inhibitor of the amino acid-sensing branch of the TORC1 pathway.2 Publications

GO - Molecular functioni

  1. protein binding Source: UniProtKB

GO - Biological processi

  1. COPII vesicle coating Source: Reactome
  2. ER to Golgi vesicle-mediated transport Source: Reactome
  3. antigen processing and presentation of exogenous peptide antigen via MHC class II Source: Reactome
  4. antigen processing and presentation of peptide antigen via MHC class I Source: Reactome
  5. cellular protein metabolic process Source: Reactome
  6. intracellular protein transport Source: UniProtKB
  7. mRNA transport Source: UniProtKB-KW
  8. membrane organization Source: Reactome
  9. mitotic cell cycle Source: Reactome
  10. post-translational protein modification Source: Reactome
  11. protein N-linked glycosylation via asparagine Source: Reactome
Complete GO annotation...

Keywords - Biological processi

ER-Golgi transport, mRNA transport, Protein transport, Translocation, Transport

Enzyme and pathway databases

ReactomeiREACT_121399. MHC class II antigen presentation.
REACT_12507. COPII (Coat Protein 2) Mediated Vesicle Transport.
REACT_150425. Resolution of Sister Chromatid Cohesion.
REACT_150471. Separation of Sister Chromatids.
REACT_682. Mitotic Prometaphase.
REACT_75795. Antigen Presentation: Folding, assembly and peptide loading of class I MHC.
SignaLinkiP55735.

Names & Taxonomyi

Protein namesi
Recommended name:
Protein SEC13 homolog
Alternative name(s):
SEC13-like protein 1
SEC13-related protein
Gene namesi
Name:SEC13
Synonyms:D3S1231E, SEC13L1, SEC13R
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 3

Organism-specific databases

HGNCiHGNC:10697. SEC13.

Subcellular locationi

Cytoplasmic vesicleCOPII-coated vesicle membrane; Peripheral membrane protein; Cytoplasmic side. Endoplasmic reticulum membrane; Peripheral membrane protein; Cytoplasmic side. Nucleusnuclear pore complex
Note: In interphase, localizes at both sides of the NPC.3 Publications

GO - Cellular componenti

  1. ER to Golgi transport vesicle membrane Source: Reactome
  2. Golgi membrane Source: GOC
  3. cytosol Source: Reactome
  4. endoplasmic reticulum membrane Source: Reactome
  5. extracellular vesicular exosome Source: UniProt
  6. nuclear envelope Source: UniProtKB
  7. nuclear pore outer ring Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasmic vesicle, Endoplasmic reticulum, Membrane, Nuclear pore complex, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA35620.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11Removed2 Publications
Chaini2 – 322321Protein SEC13 homolog
PRO_0000051203Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylvaline3 Publications
Modified residuei309 – 3091Phosphoserine1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiP55735.
PaxDbiP55735.
PRIDEiP55735.

PTM databases

PhosphoSiteiP55735.

Expressioni

Gene expression databases

ArrayExpressiP55735.
BgeeiP55735.
CleanExiHS_SEC13.
GenevestigatoriP55735.

Organism-specific databases

HPAiHPA035292.

Interactioni

Subunit structurei

At the nuclear pore: component of the Y-shaped Nup107-160 subcomplex of the nuclear pore complex (NPC). The Nup107-160 subcomplex includes NUP160, NUP133, NUP107, NUP98, NUP85, NUP43, NUP37, SEH1 and SEC13. At the COPII coat complex: interacts with SEC31A and SEC31B. Within the GATOR complex, component of the GATOR2 subcomplex, made of MIOS, SEC13, SEH1L, WDR24 and WDR59. The GATOR complex strongly interacts with RRAGA/RRAGC and RRAGB/RRAGC heterodimers.5 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
NUP145P496879EBI-1046596,EBI-11730From a different organism.

Protein-protein interaction databases

BioGridi112296. 32 interactions.
DIPiDIP-39091N.
IntActiP55735. 17 interactions.
MINTiMINT-1154053.
STRINGi9606.ENSP00000312122.

Structurei

Secondary structure

Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi16 – 216
Helixi23 – 253
Beta strandi27 – 326
Beta strandi35 – 439
Beta strandi46 – 549
Beta strandi60 – 656
Helixi68 – 703
Beta strandi74 – 785
Beta strandi83 – 864
Beta strandi89 – 913
Beta strandi95 – 995
Beta strandi108 – 1114
Turni114 – 1163
Beta strandi120 – 1234
Beta strandi125 – 1273
Beta strandi129 – 1346
Beta strandi136 – 1383
Beta strandi140 – 1423
Beta strandi148 – 1514
Beta strandi181 – 1833
Beta strandi193 – 1964
Beta strandi202 – 2065
Beta strandi215 – 2195
Beta strandi230 – 2356
Beta strandi239 – 2446
Beta strandi246 – 2494
Beta strandi257 – 2604
Beta strandi265 – 2706
Turni272 – 2743
Beta strandi277 – 2848
Beta strandi286 – 2916
Beta strandi297 – 3026

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3BG0X-ray3.15A/D/E/H1-316[»]
3BG1X-ray3.00A/D/E/H1-316[»]
ProteinModelPortaliP55735.
SMRiP55735. Positions 14-304.

Miscellaneous databases

EvolutionaryTraceiP55735.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati11 – 5040WD 1
Add
BLAST
Repeati55 – 9642WD 2
Add
BLAST
Repeati101 – 14444WD 3
Add
BLAST
Repeati148 – 20457WD 4
Add
BLAST
Repeati210 – 25344WD 5
Add
BLAST
Repeati260 – 29940WD 6
Add
BLAST

Sequence similaritiesi

Belongs to the WD repeat SEC13 family.
Contains 6 WD repeats.

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

eggNOGiCOG2319.
HOGENOMiHOG000216895.
HOVERGENiHBG057343.
InParanoidiP55735.
KOiK14004.
OrthoDBiEOG7966GP.
PhylomeDBiP55735.
TreeFamiTF300815.

Family and domain databases

Gene3Di2.130.10.10. 1 hit.
InterProiIPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF00400. WD40. 6 hits.
[Graphical view]
SMARTiSM00320. WD40. 6 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 1 hit.
PROSITEiPS50082. WD_REPEATS_2. 3 hits.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P55735-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MVSVINTVDT SHEDMIHDAQ MDYYGTRLAT CSSDRSVKIF DVRNGGQILI    50
ADLRGHEGPV WQVAWAHPMY GNILASCSYD RKVIIWREEN GTWEKSHEHA 100
GHDSSVNSVC WAPHDYGLIL ACGSSDGAIS LLTYTGEGQW EVKKINNAHT 150
IGCNAVSWAP AVVPGSLIDH PSGQKPNYIK RFASGGCDNL IKLWKEEEDG 200
QWKEEQKLEA HSDWVRDVAW APSIGLPTST IASCSQDGRV FIWTCDDASS 250
NTWSPKLLHK FNDVVWHVSW SITANILAVS GGDNKVTLWK ESVDGQWVCI 300
SDVNKGQGSV SASVTEGQQN EQ 322
Length:322
Mass (Da):35,541
Last modified:January 23, 2007 - v3
Checksum:i18E29627D87FB3DD
GO
Isoform 2 (identifier: P55735-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: Missing.

Note: No experimental confirmation available.

Show »
Length:308
Mass (Da):34,012
Checksum:iF4D5BC3F757FE7BB
GO
Isoform 3 (identifier: P55735-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MREPVLTWCVPLELLCSHPLPLSAFLKSQVKLYTYRACAGKDEMGKM

Note: No experimental confirmation available.

Show »
Length:368
Mass (Da):40,747
Checksum:iE738D9D307CF2308
GO

Sequence cautioni

The sequence AAH02634.2 differs from that shown. Reason: Erroneous initiation.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti172 – 1721S → L.
Corresponds to variant rs34078590 [ dbSNP | Ensembl ].
VAR_053413

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 1414Missing in isoform 2.
VSP_046191Add
BLAST
Alternative sequencei1 – 11M → MREPVLTWCVPLELLCSHPL PLSAFLKSQVKLYTYRACAG KDEMGKM in isoform 3.
VSP_054695

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti51 – 511A → V in L09260. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
L09260 mRNA. No translation available.
AF052155 mRNA. No translation available.
AK301999 mRNA. Translation: BAG63403.1.
AC022384 Genomic DNA. No translation available.
BC002634 mRNA. Translation: AAH02634.2. Different initiation.
BC006167 mRNA. Translation: AAH06167.1.
BC091506 mRNA. Translation: AAH91506.1.
CCDSiCCDS2599.1. [P55735-1]
CCDS46751.1. [P55735-2]
CCDS63540.1. [P55735-3]
RefSeqiNP_001129498.1. NM_001136026.2. [P55735-3]
NP_001129704.1. NM_001136232.2. [P55735-2]
NP_109598.2. NM_030673.3.
NP_899195.1. NM_183352.2. [P55735-1]
XP_005265436.1. XM_005265379.1.
XP_006713349.1. XM_006713286.1. [P55735-3]
XP_006713351.1. XM_006713288.1. [P55735-2]
UniGeneiHs.166924.

Genome annotation databases

EnsembliENST00000337354; ENSP00000336566; ENSG00000157020.
ENST00000350697; ENSP00000312122; ENSG00000157020. [P55735-1]
ENST00000383801; ENSP00000373312; ENSG00000157020.
ENST00000397109; ENSP00000380298; ENSG00000157020. [P55735-2]
GeneIDi6396.
KEGGihsa:6396.
UCSCiuc003bvl.3. human. [P55735-1]

Polymorphism databases

DMDMi50403748.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
L09260 mRNA. No translation available.
AF052155 mRNA. No translation available.
AK301999 mRNA. Translation: BAG63403.1 .
AC022384 Genomic DNA. No translation available.
BC002634 mRNA. Translation: AAH02634.2 . Different initiation.
BC006167 mRNA. Translation: AAH06167.1 .
BC091506 mRNA. Translation: AAH91506.1 .
CCDSi CCDS2599.1. [P55735-1 ]
CCDS46751.1. [P55735-2 ]
CCDS63540.1. [P55735-3 ]
RefSeqi NP_001129498.1. NM_001136026.2. [P55735-3 ]
NP_001129704.1. NM_001136232.2. [P55735-2 ]
NP_109598.2. NM_030673.3.
NP_899195.1. NM_183352.2. [P55735-1 ]
XP_005265436.1. XM_005265379.1.
XP_006713349.1. XM_006713286.1. [P55735-3 ]
XP_006713351.1. XM_006713288.1. [P55735-2 ]
UniGenei Hs.166924.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
3BG0 X-ray 3.15 A/D/E/H 1-316 [» ]
3BG1 X-ray 3.00 A/D/E/H 1-316 [» ]
ProteinModelPortali P55735.
SMRi P55735. Positions 14-304.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 112296. 32 interactions.
DIPi DIP-39091N.
IntActi P55735. 17 interactions.
MINTi MINT-1154053.
STRINGi 9606.ENSP00000312122.

PTM databases

PhosphoSitei P55735.

Polymorphism databases

DMDMi 50403748.

Proteomic databases

MaxQBi P55735.
PaxDbi P55735.
PRIDEi P55735.

Protocols and materials databases

DNASUi 6396.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000337354 ; ENSP00000336566 ; ENSG00000157020 .
ENST00000350697 ; ENSP00000312122 ; ENSG00000157020 . [P55735-1 ]
ENST00000383801 ; ENSP00000373312 ; ENSG00000157020 .
ENST00000397109 ; ENSP00000380298 ; ENSG00000157020 . [P55735-2 ]
GeneIDi 6396.
KEGGi hsa:6396.
UCSCi uc003bvl.3. human. [P55735-1 ]

Organism-specific databases

CTDi 6396.
GeneCardsi GC03M010337.
HGNCi HGNC:10697. SEC13.
HPAi HPA035292.
MIMi 600152. gene.
neXtProti NX_P55735.
PharmGKBi PA35620.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG2319.
HOGENOMi HOG000216895.
HOVERGENi HBG057343.
InParanoidi P55735.
KOi K14004.
OrthoDBi EOG7966GP.
PhylomeDBi P55735.
TreeFami TF300815.

Enzyme and pathway databases

Reactomei REACT_121399. MHC class II antigen presentation.
REACT_12507. COPII (Coat Protein 2) Mediated Vesicle Transport.
REACT_150425. Resolution of Sister Chromatid Cohesion.
REACT_150471. Separation of Sister Chromatids.
REACT_682. Mitotic Prometaphase.
REACT_75795. Antigen Presentation: Folding, assembly and peptide loading of class I MHC.
SignaLinki P55735.

Miscellaneous databases

EvolutionaryTracei P55735.
GeneWikii SEC13.
GenomeRNAii 6396.
NextBioi 24846.
PROi P55735.
SOURCEi Search...

Gene expression databases

ArrayExpressi P55735.
Bgeei P55735.
CleanExi HS_SEC13.
Genevestigatori P55735.

Family and domain databases

Gene3Di 2.130.10.10. 1 hit.
InterProi IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR017986. WD40_repeat_dom.
[Graphical view ]
Pfami PF00400. WD40. 6 hits.
[Graphical view ]
SMARTi SM00320. WD40. 6 hits.
[Graphical view ]
SUPFAMi SSF50978. SSF50978. 1 hit.
PROSITEi PS50082. WD_REPEATS_2. 3 hits.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular characterization of a novel human gene, SEC13R, related to the yeast secretory pathway gene SEC13, and mapping to a conserved linkage group on human chromosome 3p24-p25 and mouse chromosome 6."
    Swaroop A., Yang-Feng T.L., Liu W., Gieser L., Barrow L.L., Chen K.C., Agarwal N., Meisler M.H., Smith D.I.
    Hum. Mol. Genet. 3:1281-1286(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "Large-scale concatenation cDNA sequencing."
    Yu W., Andersson B., Worley K.C., Muzny D.M., Ding Y., Liu W., Ricafrente J.Y., Wentland M.A., Lennon G., Gibbs R.A.
    Genome Res. 7:353-358(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Testis.
  4. "The DNA sequence, annotation and analysis of human chromosome 3."
    Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
    , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
    Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Placenta and Uterus.
  6. "Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides."
    Gevaert K., Goethals M., Martens L., Van Damme J., Staes A., Thomas G.R., Vandekerckhove J.
    Nat. Biotechnol. 21:566-569(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 2-27.
    Tissue: Platelet.
  7. Bienvenut W.V., Waridel P., Quadroni M.
    Submitted (MAR-2009) to UniProtKB
    Cited for: PROTEIN SEQUENCE OF 2-27; 44-54; 217-256 AND 291-322, CLEAVAGE OF INITIATOR METHIONINE, ACETYLATION AT VAL-2, IDENTIFICATION BY MASS SPECTROMETRY.
    Tissue: Embryonic kidney.
  8. Lubec G., Chen W.-Q., Sun Y.
    Submitted (DEC-2008) to UniProtKB
    Cited for: PROTEIN SEQUENCE OF 182-192; 217-239 AND 291-322, IDENTIFICATION BY MASS SPECTROMETRY.
    Tissue: Fetal brain cortex.
  9. "The mammalian homolog of yeast Sec13p is enriched in the intermediate compartment and is essential for protein transport from the endoplasmic reticulum to the Golgi apparatus."
    Tang B.L., Peter F., Krijnse-Locker J., Low S.H., Griffiths G., Hong W.
    Mol. Cell. Biol. 17:256-266(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION.
  10. "Sec13 shuttles between the nucleus and the cytoplasm and stably interacts with Nup96 at the nuclear pore complex."
    Enninga J., Levay A., Fontoura B.M.
    Mol. Cell. Biol. 23:7271-7284(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION, INTERACTION WITH NUP96.
  11. "Human Sec31B: a family of new mammalian orthologues of yeast Sec31p that associate with the COPII coat."
    Stankewich M.C., Stabach P.R., Morrow J.S.
    J. Cell Sci. 119:958-969(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH SEC31B.
  12. "The Ca2+-binding protein ALG-2 is recruited to endoplasmic reticulum exit sites by Sec31A and stabilizes the localization of Sec31A."
    Yamasaki A., Tani K., Yamamoto A., Kitamura N., Komada M.
    Mol. Biol. Cell 17:4876-4887(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH SEC31A.
  13. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT VAL-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  14. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-309, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  15. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  16. "Comparative large-scale characterisation of plant vs. mammal proteins reveals similar and idiosyncratic N-alpha acetylation features."
    Bienvenut W.V., Sumpton D., Martinez A., Lilla S., Espagne C., Meinnel T., Giglione C.
    Mol. Cell. Proteomics 11:M111.015131-M111.015131(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT VAL-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  17. "A Tumor suppressor complex with GAP activity for the Rag GTPases that signal amino acid sufficiency to mTORC1."
    Bar-Peled L., Chantranupong L., Cherniack A.D., Chen W.W., Ottina K.A., Grabiner B.C., Spear E.D., Carter S.L., Meyerson M., Sabatini D.M.
    Science 340:1100-1106(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, IDENTIFICATION IN GATOR COMPLEX, INTERACTION WITH RRAG PROTEINS.
  18. "Architecture of a coat for the nuclear pore membrane."
    Hsia K.C., Stavropoulos P., Blobel G., Hoelz A.
    Cell 131:1313-1326(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (3.0 ANGSTROMS) OF 1-316 IN COMPLEX WITH YEAST NUP145C, SUBUNIT, SUBCELLULAR LOCATION.

Entry informationi

Entry nameiSEC13_HUMAN
AccessioniPrimary (citable) accession number: P55735
Secondary accession number(s): A8MV37
, B4DXJ1, Q5BJF0, Q9BRM6, Q9BUG7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: January 23, 2007
Last modified: September 3, 2014
This is version 139 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi