Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P55327 (TPD52_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 125. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Tumor protein D52
Alternative name(s):
Protein N8
Gene names
Name:TPD52
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length224 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Subunit structure

Forms a homodimer or heterodimer with other members of the family. All isoforms interact with several 14-3-3 proteins.

Tissue specificity

Isoform 2 is expressed in colon, breast, prostate, pancreas and kidney tumor cell lines. Isoform 2 is expressed at high levels in kidney, prostate, brain, small intestine and pancreas, at moderate levels in placenta and colon, at low levels in lung, liver and heart, and at very low levels in spleen, thymus, peripheral mononuclear blood cells, testis and ovary. Ref.2

Developmental stage

Isoform 2 is expressed at lower levels in fetal brain and kidney than in adult brain and kidney. Ref.2

Sequence similarities

Belongs to the TPD52 family.

Sequence caution

The sequence BAD97351.1 differs from that shown. Reason: Erroneous initiation.

Binary interactions

With

Entry

#Exp.

IntAct

Notes

Tpd52Q623932EBI-782581,EBI-782591From a different organism.
TPD52L1Q168903EBI-782581,EBI-717470

Alternative products

This entry describes 8 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: P55327-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: P55327-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-46: MDCREMDLYEDYQSPFDFDAGVNKSYLYLSPSGNSSPPGSPTLQKF → MDRGEQ
Isoform 3 (identifier: P55327-3)

Also known as: N8L;

The sequence of this isoform differs from the canonical sequence as follows:
     1-46: MDCREMDLYE...PPGSPTLQKF → MTPRESAPGR...RAGDMDRGEQ
Isoform 4 (identifier: P55327-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-46: MDCREMDLYEDYQSPFDFDAGVNKSYLYLSPSGNSSPPGSPTLQKF → MDRGEQ
     169-169: K → KLQAFSHSFSIRSIQHSISMPAMR
Note: No experimental confirmation available.
Isoform 5 (identifier: P55327-5)

Also known as: PrLZ-238;

The sequence of this isoform differs from the canonical sequence as follows:
     168-169: VK → VNIRSIQHSISMPAMR
Isoform 6 (identifier: P55327-6)

Also known as: PrLZ-247;

The sequence of this isoform differs from the canonical sequence as follows:
     169-169: K → KLQAFSHSFSIRSIQHSISMPAMR
Isoform 7 (identifier: P55327-7)

Also known as: PrLZ-233;

The sequence of this isoform differs from the canonical sequence as follows:
     169-169: K → KLQAFSHSFR
Isoform 8 (identifier: P55327-8)

Also known as: PrLZ-151;

The sequence of this isoform differs from the canonical sequence as follows:
     136-224: YKKTSETLSQ...PLPEKTQESL → RSKLLAAETELLCLLY
Note: Interacts only with YWHAB and YWHAQ among 14-3-3 proteins.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 224224Tumor protein D52
PRO_0000185738

Regions

Coiled coil62 – 11453 Potential

Amino acid modifications

Modified residue1711Phosphoserine Ref.15
Modified residue1731Phosphothreonine Ref.15
Modified residue1761Phosphoserine Ref.16 Ref.18
Modified residue2231Phosphoserine Ref.15

Natural variations

Alternative sequence1 – 4646MDCRE…TLQKF → MDRGEQ in isoform 2 and isoform 4.
VSP_035751
Alternative sequence1 – 4646MDCRE…TLQKF → MTPRESAPGRGRAAPPRPTP LGVGTSRESPAEARRSSARR GGRSEPGRAAGGGAAEDTRR RAGDMDRGEQ in isoform 3.
VSP_037378
Alternative sequence136 – 22489YKKTS…TQESL → RSKLLAAETELLCLLY in isoform 8.
VSP_047718
Alternative sequence168 – 1692VK → VNIRSIQHSISMPAMR in isoform 5.
VSP_047719
Alternative sequence1691K → KLQAFSHSFSIRSIQHSISM PAMR in isoform 4 and isoform 6.
VSP_043510
Alternative sequence1691K → KLQAFSHSFR in isoform 7.
VSP_047720
Natural variant521D → Y.
Corresponds to variant rs35099105 [ dbSNP | Ensembl ].
VAR_061860

Experimental info

Sequence conflict741E → K in BAD97351. Ref.9
Sequence conflict1651L → P in CAG46831. Ref.6

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified November 25, 2008. Version 2.
Checksum: 4C8183C5914BB976

FASTA22424,327
        10         20         30         40         50         60 
MDCREMDLYE DYQSPFDFDA GVNKSYLYLS PSGNSSPPGS PTLQKFGLLR TDPVPEEGED 

        70         80         90        100        110        120 
VAATISATET LSEEEQEELR RELAKVEEEI QTLSQVLAAK EKHLAEIKRK LGINSLQELK 

       130        140        150        160        170        180 
QNIAKGWQDV TATSAYKKTS ETLSQAGQKA SAAFSSVGSV ITKKLEDVKN SPTFKSFEEK 

       190        200        210        220 
VENLKSKVGG TKPAGGDFGE VLNSAANASA TTTEPLPEKT QESL 

« Hide

Isoform 2 [UniParc].

Checksum: 4821EC86D1C3339D
Show »

FASTA18419,863
Isoform 3 (N8L) [UniParc].

Checksum: B7D203C4941A02B2
Show »

FASTA24826,382
Isoform 4 [UniParc].

Checksum: 29027F1706989362
Show »

FASTA20722,477
Isoform 5 (PrLZ-238) [UniParc].

Checksum: 8E02245A52BF64C7
Show »

FASTA23825,922
Isoform 6 (PrLZ-247) [UniParc].

Checksum: F9526200A91B6ABB
Show »

FASTA24726,941
Isoform 7 (PrLZ-233) [UniParc].

Checksum: A722640EFE14A677
Show »

FASTA23325,401
Isoform 8 (PrLZ-151) [UniParc].

Checksum: 5270A0BAF1F81B70
Show »

FASTA15116,853

References

« Hide 'large scale' references
[1]"A screening method to identify genes commonly overexpressed in carcinomas and the identification of a novel complementary DNA sequence."
Byrne J.A., Tomasetto C., Garnier J.-M., Rouyer N., Mattei M.-G., Bellocq J.-P., Rio M.C., Basset P.
Cancer Res. 55:2896-2903(1995) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
Tissue: Mammary carcinoma.
[2]"Isolation and characterization of a novel gene expressed in multiple cancers."
Chen S.-L., Maroulakou I.G., Green J.E., Romano-Spica V., Modi W., Lautenberger J., Bhat N.K.
Oncogene 12:741-751(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE, ALTERNATIVE SPLICING.
Tissue: Lung tumor.
[3]"PrLZ, a novel prostate-specific and androgen-responsive gene of the TPD52 family, amplified in chromosome 8q21.1 and overexpressed in human prostate cancer."
Wang R., Xu J., Saramaki O., Visakorpi T., Sutherland W.M., Zhou J., Sen B., Lim S.D., Mabjeesh N., Amin M., Dong J.T., Petros J.A., Nelson P.S., Marshall F.F., Zhau H.E., Chung L.W.
Cancer Res. 64:1589-1594(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[4]"Transcription variants of the prostate-specific PrLZ gene and their interaction with 14-3-3 proteins."
Wang R., He H., Sun X., Xu J., Marshall F.F., Zhau H., Chung L.W., Fu H., He D.
Biochem. Biophys. Res. Commun. 389:455-460(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 5; 6; 7 AND 8), ALTERNATIVE SPLICING, INTERACTION WITH 14-3-3 PROTEINS.
[5]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 4).
Tissue: Colon, Hippocampus and Tongue.
[6]"Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
[7]"Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
[8]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Rectum tumor.
[9]Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Spleen.
[10]"DNA sequence and analysis of human chromosome 8."
Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. expand/collapse author list , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.
Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[11]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[12]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Skin.
[13]"Identification of homo- and heteromeric interactions between members of the breast carcinoma-associated D52 protein family using the yeast two-hybrid system."
Byrne J.A., Nourse C.R., Basset P., Gunning P.
Oncogene 16:873-881(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION.
[14]"Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[15]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-171; THR-173 AND SER-223, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[16]"Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-176, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[17]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[18]"System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-176, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
U18914 mRNA. Translation: AAC50183.1.
S82081 mRNA. Translation: AAB36475.1.
AF202897 mRNA. Translation: AAO22156.1.
GQ499324 mRNA. Translation: ACY08776.1.
GQ499325 mRNA. Translation: ACY08777.1.
GQ499326 mRNA. Translation: ACY08778.1.
GQ499327 mRNA. Translation: ACY08779.1.
GQ499328 mRNA. Translation: ACY08780.1.
AK295468 mRNA. Translation: BAH12078.1.
AK296615 mRNA. Translation: BAH12400.1.
AK313135 mRNA. Translation: BAG35954.1.
CR542034 mRNA. Translation: CAG46831.1.
CR542064 mRNA. Translation: CAG46861.1.
BT019444 mRNA. Translation: AAV38251.1.
BX640835 mRNA. Translation: CAE45908.1.
AK223631 mRNA. Translation: BAD97351.1. Different initiation.
AC009686 Genomic DNA. No translation available.
AC018952 Genomic DNA. No translation available.
AC036214 Genomic DNA. No translation available.
AC104212 Genomic DNA. No translation available.
CH471068 Genomic DNA. Translation: EAW87074.1.
BC018117 mRNA. Translation: AAH18117.1.
CCDSCCDS34912.1. [P55327-1]
CCDS47879.1. [P55327-4]
CCDS55249.1. [P55327-2]
PIRI38910.
RefSeqNP_001020423.1. NM_001025252.2. [P55327-1]
NP_001020424.1. NM_001025253.2. [P55327-4]
NP_001274069.1. NM_001287140.1. [P55327-6]
NP_001274071.1. NM_001287142.1. [P55327-5]
NP_001274072.1. NM_001287143.1. [P55327-7]
NP_001274073.1. NM_001287144.1.
NP_005070.1. NM_005079.3. [P55327-2]
UniGeneHs.368433.

3D structure databases

ProteinModelPortalP55327.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid113016. 20 interactions.
IntActP55327. 9 interactions.
MINTMINT-3021043.
STRING9606.ENSP00000368391.

PTM databases

PhosphoSiteP55327.

Polymorphism databases

DMDM215273966.

Proteomic databases

MaxQBP55327.
PaxDbP55327.
PRIDEP55327.

Protocols and materials databases

DNASU7163.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000379096; ENSP00000368390; ENSG00000076554. [P55327-2]
ENST00000379097; ENSP00000368391; ENSG00000076554. [P55327-1]
ENST00000448733; ENSP00000410222; ENSG00000076554. [P55327-5]
ENST00000517427; ENSP00000429351; ENSG00000076554. [P55327-7]
ENST00000517462; ENSP00000429708; ENSG00000076554. [P55327-8]
ENST00000518937; ENSP00000429915; ENSG00000076554. [P55327-4]
ENST00000520527; ENSP00000429309; ENSG00000076554. [P55327-6]
GeneID7163.
KEGGhsa:7163.
UCSCuc003ybr.1. human. [P55327-1]
uc003ybs.1. human. [P55327-4]
uc003ybt.1. human. [P55327-2]

Organism-specific databases

CTD7163.
GeneCardsGC08M080870.
H-InvDBHIX0152680.
HGNCHGNC:12005. TPD52.
HPAHPA028427.
MIM604068. gene.
neXtProtNX_P55327.
PharmGKBPA36686.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG251958.
HOVERGENHBG058643.
InParanoidP55327.
OMAMDFYEDY.
OrthoDBEOG744TBQ.
PhylomeDBP55327.
TreeFamTF317562.

Enzyme and pathway databases

ReactomeREACT_11123. Membrane Trafficking.

Gene expression databases

ArrayExpressP55327.
BgeeP55327.
CleanExHS_TPD52.
GenevestigatorP55327.

Family and domain databases

InterProIPR007327. TPD52.
[Graphical view]
PANTHERPTHR19307. PTHR19307. 1 hit.
PfamPF04201. TPD52. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSTPD52. human.
GeneWikiTPD52.
GenomeRNAi7163.
NextBio28030.
PROP55327.
SOURCESearch...

Entry information

Entry nameTPD52_HUMAN
AccessionPrimary (citable) accession number: P55327
Secondary accession number(s): B7Z414 expand/collapse secondary AC list , C9J502, D0UFD1, D0UFD2, D0UFD3, D0UFD4, D0UFD5, E5RKB4, Q13056, Q53EK8, Q6FGP3, Q6FGS3, Q86YZ2, Q9UCX8
Entry history
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: November 25, 2008
Last modified: July 9, 2014
This is version 125 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 8

Human chromosome 8: entries, gene names and cross-references to MIM