P55327 (TPD52_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 112.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Tumor protein D52 Alternative name(s): Protein N8 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 224 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Subunit structure | Forms a homodimer or heterodimer with other members of the family. |
| Tissue specificity | Isoform 2 is expressed in colon, breast, prostate, pancreas and kidney tumor cell lines. Isoform 2 is expressed at high levels in kidney, prostate, brain, small intestine and pancreas, at moderate levels in placenta and colon, at low levels in lung, liver and heart, and at very low levels in spleen, thymus, peripheral mononuclear blood cells, testis and ovary. Ref.2 |
| Developmental stage | Isoform 2 is expressed at lower levels in fetal brain and kidney than in adult brain and kidney. Ref.2 |
| Sequence similarities | Belongs to the TPD52 family. |
| Sequence caution | The sequence BAD97351.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Coiled coil |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | B cell differentiation Inferred from expression pattern PubMed 15576473. Source: UniProtKB anatomical structure morphogenesisTraceable author statement Ref.2. Source: ProtInc secretionTraceable author statement PubMed 15576473. Source: UniProtKB |
| Cellular_component | endoplasmic reticulum Inferred from direct assay PubMed 10942595. Source: UniProtKB perinuclear region of cytoplasmInferred from direct assay PubMed 16112108. Source: UniProtKB |
| Molecular_function | calcium ion binding Inferred from direct assay PubMed 15576473. Source: UniProtKB protein heterodimerization activityInferred from direct assay Ref.12. Source: UniProtKB protein homodimerization activityInferred from direct assay Ref.12. Source: UniProtKB |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| Tpd52 | Q62393 | 2 | EBI-782581,EBI-782591 | From a different organism. |
| TPD52L1 | Q16890 | 3 | EBI-782581,EBI-717470 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P55327-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P55327-2) The sequence of this isoform differs from the canonical sequence as follows: 1-46: MDCREMDLYEDYQSPFDFDAGVNKSYLYLSPSGNSSPPGSPTLQKF → MDRGEQ | ||||||
| Isoform 3 (identifier: P55327-3) Also known as: N8L; The sequence of this isoform differs from the canonical sequence as follows: 1-46: MDCREMDLYE...PPGSPTLQKF → MTPRESAPGR...RAGDMDRGEQ | ||||||
| Isoform 4 (identifier: P55327-4) The sequence of this isoform differs from the canonical sequence as follows: 1-46: MDCREMDLYEDYQSPFDFDAGVNKSYLYLSPSGNSSPPGSPTLQKF → MDRGEQ 169-169: K → KLQAFSHSFSIRSIQHSISMPAMR | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 224 | 224 | Tumor protein D52 | PRO_0000185738 | |||||
Regions | |||||||||
| Coiled coil | 62 – 114 | 53 | Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 171 | 1 | Phosphoserine Ref.14 | ||||||
| Modified residue | 173 | 1 | Phosphothreonine Ref.14 | ||||||
| Modified residue | 176 | 1 | Phosphoserine Ref.15 Ref.17 | ||||||
| Modified residue | 223 | 1 | Phosphoserine Ref.14 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 46 | 46 | MDCRE…TLQKF → MDRGEQ in isoform 2 and isoform 4. | VSP_035751 | |||||
| Alternative sequence | 1 – 46 | 46 | MDCRE…TLQKF → MTPRESAPGRGRAAPPRPTP LGVGTSRESPAEARRSSARR GGRSEPGRAAGGGAAEDTRR RAGDMDRGEQ in isoform 3. | VSP_037378 | |||||
| Alternative sequence | 169 | 1 | K → KLQAFSHSFSIRSIQHSISM PAMR in isoform 4. | VSP_043510 | |||||
| Natural variant | 52 | 1 | D → Y. Corresponds to variant rs35099105 [ dbSNP | Ensembl ]. | VAR_061860 | |||||
Experimental info | |||||||||
| Sequence conflict | 74 | 1 | E → K in BAD97351. Ref.8 | ||||||
| Sequence conflict | 165 | 1 | L → P in CAG46831. Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A screening method to identify genes commonly overexpressed in carcinomas and the identification of a novel complementary DNA sequence." Byrne J.A., Tomasetto C., Garnier J.-M., Rouyer N., Mattei M.-G., Bellocq J.-P., Rio M.C., Basset P. Cancer Res. 55:2896-2903(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Tissue: Mammary carcinoma. |
| [2] | "Isolation and characterization of a novel gene expressed in multiple cancers." Chen S.-L., Maroulakou I.G., Green J.E., Romano-Spica V., Modi W., Lautenberger J., Bhat N.K. Oncogene 12:741-751(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE, ALTERNATIVE SPLICING. Tissue: Lung tumor. |
| [3] | "PrLZ, a novel prostate-specific and androgen-responsive gene of the TPD52 family, amplified in chromosome 8q21.1 and overexpressed in human prostate cancer." Wang R., Xu J., Saramaki O., Visakorpi T., Sutherland W.M., Zhou J., Sen B., Lim S.D., Mabjeesh N., Amin M., Dong J.T., Petros J.A., Nelson P.S., Marshall F.F., Zhau H.E., Chung L.W. Cancer Res. 64:1589-1594(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 4). Tissue: Colon, Hippocampus and Tongue. |
| [5] | "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [6] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [7] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Rectum tumor. |
| [8] | Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S. Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Spleen. |
| [9] | "DNA sequence and analysis of human chromosome 8." Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. Lander E.S.Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [10] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [11] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Skin. |
| [12] | "Identification of homo- and heteromeric interactions between members of the breast carcinoma-associated D52 protein family using the yeast two-hybrid system." Byrne J.A., Nourse C.R., Basset P., Gunning P. Oncogene 16:873-881(1998) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION. |
| [13] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [14] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-171; THR-173 AND SER-223, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [15] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-176, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [16] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [17] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-176, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U18914 mRNA. Translation: AAC50183.1. S82081 mRNA. Translation: AAB36475.1. AF202897 mRNA. Translation: AAO22156.1. AK295468 mRNA. Translation: BAH12078.1. AK296615 mRNA. Translation: BAH12400.1. AK313135 mRNA. Translation: BAG35954.1. CR542034 mRNA. Translation: CAG46831.1. CR542064 mRNA. Translation: CAG46861.1. BT019444 mRNA. Translation: AAV38251.1. BX640835 mRNA. Translation: CAE45908.1. AK223631 mRNA. Translation: BAD97351.1. Different initiation. AC009686 Genomic DNA. No translation available. AC018952 Genomic DNA. No translation available. AC036214 Genomic DNA. No translation available. AC104212 Genomic DNA. No translation available. CH471068 Genomic DNA. Translation: EAW87074.1. BC018117 mRNA. Translation: AAH18117.1. |
| IPI | IPI00619958. IPI00873344. IPI00896474. IPI00941154. |
| PIR | I38910. |
| RefSeq | NP_001020423.1. NM_001025252.1. NP_001020424.1. NM_001025253.1. NP_005070.1. NM_005079.2. |
| UniGene | Hs.368433. |
3D structure databases | |
| ProteinModelPortal | P55327. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P55327. 7 interactions. |
| MINT | MINT-5003652. |
| STRING | 9606.ENSP00000368391. |
PTM databases | |
| PhosphoSite | P55327. |
Polymorphism databases | |
| DMDM | 215273966. |
Proteomic databases | |
| PaxDb | P55327. |
| PRIDE | P55327. |
Protocols and materials databases | |
| DNASU | 7163. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000379096; ENSP00000368390; ENSG00000076554. ENST00000379097; ENSP00000368391; ENSG00000076554. ENST00000518937; ENSP00000429915; ENSG00000076554. |
| GeneID | 7163. |
| KEGG | hsa:7163. |
| UCSC | uc003ybr.1. human. uc003ybt.1. human. |
Organism-specific databases | |
| CTD | 7163. |
| GeneCards | GC08M080870. |
| H-InvDB | HIX0152680. |
| HGNC | HGNC:12005. TPD52. |
| HPA | HPA028427. |
| MIM | 604068. gene. |
| neXtProt | NX_P55327. |
| PharmGKB | PA36686. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG251958. |
| HOVERGEN | HBG058643. |
| InParanoid | P55327. |
Enzyme and pathway databases | |
| Reactome | REACT_11123. Membrane Trafficking. |
Gene expression databases | |
| ArrayExpress | P55327. |
| Bgee | P55327. |
| CleanEx | HS_TPD52. |
| Genevestigator | P55327. |
| GermOnline | ENSG00000076554. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR007327. TPD52. [Graphical view] |
| PANTHER | PTHR19307. PTHR19307. 1 hit. |
| Pfam | PF04201. TPD52. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | TPD52. human. |
| GenomeRNAi | 7163. |
| NextBio | 28030. |
| SOURCE | Search... |
Entry information
| Entry name | TPD52_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P55327 Secondary accession number(s): B7Z414 Q9UCX8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
