Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P55327

- TPD52_HUMAN

UniProt

P55327 - TPD52_HUMAN

Protein

Tumor protein D52

Gene

TPD52

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 127 (01 Oct 2014)
      Sequence version 2 (25 Nov 2008)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    GO - Molecular functioni

    1. calcium ion binding Source: UniProtKB
    2. protein binding Source: UniProtKB
    3. protein heterodimerization activity Source: UniProtKB
    4. protein homodimerization activity Source: UniProtKB

    GO - Biological processi

    1. anatomical structure morphogenesis Source: ProtInc
    2. B cell differentiation Source: UniProtKB
    3. secretion Source: UniProtKB

    Enzyme and pathway databases

    ReactomeiREACT_19400. Golgi Associated Vesicle Biogenesis.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Tumor protein D52
    Alternative name(s):
    Protein N8
    Gene namesi
    Name:TPD52
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 8

    Organism-specific databases

    HGNCiHGNC:12005. TPD52.

    Subcellular locationi

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB
    2. endoplasmic reticulum Source: UniProtKB
    3. perinuclear region of cytoplasm Source: UniProtKB

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA36686.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 224224Tumor protein D52PRO_0000185738Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei171 – 1711Phosphoserine1 Publication
    Modified residuei173 – 1731Phosphothreonine1 Publication
    Modified residuei176 – 1761Phosphoserine2 Publications
    Modified residuei223 – 2231Phosphoserine1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiP55327.
    PaxDbiP55327.
    PRIDEiP55327.

    PTM databases

    PhosphoSiteiP55327.

    Expressioni

    Tissue specificityi

    Isoform 2 is expressed in colon, breast, prostate, pancreas and kidney tumor cell lines. Isoform 2 is expressed at high levels in kidney, prostate, brain, small intestine and pancreas, at moderate levels in placenta and colon, at low levels in lung, liver and heart, and at very low levels in spleen, thymus, peripheral mononuclear blood cells, testis and ovary.1 Publication

    Developmental stagei

    Isoform 2 is expressed at lower levels in fetal brain and kidney than in adult brain and kidney.1 Publication

    Gene expression databases

    ArrayExpressiP55327.
    BgeeiP55327.
    CleanExiHS_TPD52.
    GenevestigatoriP55327.

    Organism-specific databases

    HPAiHPA028427.

    Interactioni

    Subunit structurei

    Forms a homodimer or heterodimer with other members of the family. All isoforms interact with several 14-3-3 proteins.

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    Tpd52Q623932EBI-782581,EBI-782591From a different organism.
    TPD52L1Q168903EBI-782581,EBI-717470

    Protein-protein interaction databases

    BioGridi113016. 20 interactions.
    IntActiP55327. 9 interactions.
    MINTiMINT-3021043.
    STRINGi9606.ENSP00000368391.

    Structurei

    3D structure databases

    ProteinModelPortaliP55327.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili62 – 11453Sequence AnalysisAdd
    BLAST

    Sequence similaritiesi

    Belongs to the TPD52 family.Curated

    Keywords - Domaini

    Coiled coil

    Phylogenomic databases

    eggNOGiNOG251958.
    HOVERGENiHBG058643.
    InParanoidiP55327.
    OMAiMDFYEDY.
    OrthoDBiEOG744TBQ.
    PhylomeDBiP55327.
    TreeFamiTF317562.

    Family and domain databases

    InterProiIPR007327. TPD52.
    [Graphical view]
    PANTHERiPTHR19307. PTHR19307. 1 hit.
    PfamiPF04201. TPD52. 1 hit.
    [Graphical view]

    Sequences (8)i

    Sequence statusi: Complete.

    This entry describes 8 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P55327-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MDCREMDLYE DYQSPFDFDA GVNKSYLYLS PSGNSSPPGS PTLQKFGLLR    50
    TDPVPEEGED VAATISATET LSEEEQEELR RELAKVEEEI QTLSQVLAAK 100
    EKHLAEIKRK LGINSLQELK QNIAKGWQDV TATSAYKKTS ETLSQAGQKA 150
    SAAFSSVGSV ITKKLEDVKN SPTFKSFEEK VENLKSKVGG TKPAGGDFGE 200
    VLNSAANASA TTTEPLPEKT QESL 224
    Length:224
    Mass (Da):24,327
    Last modified:November 25, 2008 - v2
    Checksum:i4C8183C5914BB976
    GO
    Isoform 2 (identifier: P55327-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-46: MDCREMDLYEDYQSPFDFDAGVNKSYLYLSPSGNSSPPGSPTLQKF → MDRGEQ

    Show »
    Length:184
    Mass (Da):19,863
    Checksum:i4821EC86D1C3339D
    GO
    Isoform 3 (identifier: P55327-3) [UniParc]FASTAAdd to Basket

    Also known as: N8L

    The sequence of this isoform differs from the canonical sequence as follows:
         1-46: MDCREMDLYE...PPGSPTLQKF → MTPRESAPGR...RAGDMDRGEQ

    Show »
    Length:248
    Mass (Da):26,382
    Checksum:iB7D203C4941A02B2
    GO
    Isoform 4 (identifier: P55327-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-46: MDCREMDLYEDYQSPFDFDAGVNKSYLYLSPSGNSSPPGSPTLQKF → MDRGEQ
         169-169: K → KLQAFSHSFSIRSIQHSISMPAMR

    Note: No experimental confirmation available.

    Show »
    Length:207
    Mass (Da):22,477
    Checksum:i29027F1706989362
    GO
    Isoform 5 (identifier: P55327-5) [UniParc]FASTAAdd to Basket

    Also known as: PrLZ-238

    The sequence of this isoform differs from the canonical sequence as follows:
         168-169: VK → VNIRSIQHSISMPAMR

    Show »
    Length:238
    Mass (Da):25,922
    Checksum:i8E02245A52BF64C7
    GO
    Isoform 6 (identifier: P55327-6) [UniParc]FASTAAdd to Basket

    Also known as: PrLZ-247

    The sequence of this isoform differs from the canonical sequence as follows:
         169-169: K → KLQAFSHSFSIRSIQHSISMPAMR

    Show »
    Length:247
    Mass (Da):26,941
    Checksum:iF9526200A91B6ABB
    GO
    Isoform 7 (identifier: P55327-7) [UniParc]FASTAAdd to Basket

    Also known as: PrLZ-233

    The sequence of this isoform differs from the canonical sequence as follows:
         169-169: K → KLQAFSHSFR

    Show »
    Length:233
    Mass (Da):25,401
    Checksum:iA722640EFE14A677
    GO
    Isoform 8 (identifier: P55327-8) [UniParc]FASTAAdd to Basket

    Also known as: PrLZ-151

    The sequence of this isoform differs from the canonical sequence as follows:
         136-224: YKKTSETLSQ...PLPEKTQESL → RSKLLAAETELLCLLY

    Note: Interacts only with YWHAB and YWHAQ among 14-3-3 proteins.

    Show »
    Length:151
    Mass (Da):16,853
    Checksum:i5270A0BAF1F81B70
    GO

    Sequence cautioni

    The sequence BAD97351.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti74 – 741E → K in BAD97351. 1 PublicationCurated
    Sequence conflicti165 – 1651L → P in CAG46831. 1 PublicationCurated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti52 – 521D → Y.
    Corresponds to variant rs35099105 [ dbSNP | Ensembl ].
    VAR_061860

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 4646MDCRE…TLQKF → MDRGEQ in isoform 2 and isoform 4. 7 PublicationsVSP_035751Add
    BLAST
    Alternative sequencei1 – 4646MDCRE…TLQKF → MTPRESAPGRGRAAPPRPTP LGVGTSRESPAEARRSSARR GGRSEPGRAAGGGAAEDTRR RAGDMDRGEQ in isoform 3. 1 PublicationVSP_037378Add
    BLAST
    Alternative sequencei136 – 22489YKKTS…TQESL → RSKLLAAETELLCLLY in isoform 8. 1 PublicationVSP_047718Add
    BLAST
    Alternative sequencei168 – 1692VK → VNIRSIQHSISMPAMR in isoform 5. 1 PublicationVSP_047719
    Alternative sequencei169 – 1691K → KLQAFSHSFSIRSIQHSISM PAMR in isoform 4 and isoform 6. 2 PublicationsVSP_043510
    Alternative sequencei169 – 1691K → KLQAFSHSFR in isoform 7. 1 PublicationVSP_047720

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U18914 mRNA. Translation: AAC50183.1.
    S82081 mRNA. Translation: AAB36475.1.
    AF202897 mRNA. Translation: AAO22156.1.
    GQ499324 mRNA. Translation: ACY08776.1.
    GQ499325 mRNA. Translation: ACY08777.1.
    GQ499326 mRNA. Translation: ACY08778.1.
    GQ499327 mRNA. Translation: ACY08779.1.
    GQ499328 mRNA. Translation: ACY08780.1.
    AK295468 mRNA. Translation: BAH12078.1.
    AK296615 mRNA. Translation: BAH12400.1.
    AK313135 mRNA. Translation: BAG35954.1.
    CR542034 mRNA. Translation: CAG46831.1.
    CR542064 mRNA. Translation: CAG46861.1.
    BT019444 mRNA. Translation: AAV38251.1.
    BX640835 mRNA. Translation: CAE45908.1.
    AK223631 mRNA. Translation: BAD97351.1. Different initiation.
    AC009686 Genomic DNA. No translation available.
    AC018952 Genomic DNA. No translation available.
    AC036214 Genomic DNA. No translation available.
    AC104212 Genomic DNA. No translation available.
    CH471068 Genomic DNA. Translation: EAW87074.1.
    BC018117 mRNA. Translation: AAH18117.1.
    CCDSiCCDS34912.1. [P55327-1]
    CCDS47879.1. [P55327-4]
    CCDS55249.1. [P55327-2]
    PIRiI38910.
    RefSeqiNP_001020423.1. NM_001025252.2. [P55327-1]
    NP_001020424.1. NM_001025253.2. [P55327-4]
    NP_001274069.1. NM_001287140.1. [P55327-6]
    NP_001274071.1. NM_001287142.1. [P55327-5]
    NP_001274072.1. NM_001287143.1. [P55327-7]
    NP_001274073.1. NM_001287144.1.
    NP_005070.1. NM_005079.3. [P55327-2]
    UniGeneiHs.368433.

    Genome annotation databases

    EnsembliENST00000379096; ENSP00000368390; ENSG00000076554. [P55327-2]
    ENST00000379097; ENSP00000368391; ENSG00000076554. [P55327-1]
    ENST00000448733; ENSP00000410222; ENSG00000076554. [P55327-5]
    ENST00000517427; ENSP00000429351; ENSG00000076554. [P55327-7]
    ENST00000517462; ENSP00000429708; ENSG00000076554. [P55327-8]
    ENST00000518937; ENSP00000429915; ENSG00000076554. [P55327-4]
    ENST00000520527; ENSP00000429309; ENSG00000076554. [P55327-6]
    GeneIDi7163.
    KEGGihsa:7163.
    UCSCiuc003ybr.1. human. [P55327-1]
    uc003ybs.1. human. [P55327-4]
    uc003ybt.1. human. [P55327-2]

    Polymorphism databases

    DMDMi215273966.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    Atlas of Genetics and Cytogenetics in Oncology and Haematology

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U18914 mRNA. Translation: AAC50183.1 .
    S82081 mRNA. Translation: AAB36475.1 .
    AF202897 mRNA. Translation: AAO22156.1 .
    GQ499324 mRNA. Translation: ACY08776.1 .
    GQ499325 mRNA. Translation: ACY08777.1 .
    GQ499326 mRNA. Translation: ACY08778.1 .
    GQ499327 mRNA. Translation: ACY08779.1 .
    GQ499328 mRNA. Translation: ACY08780.1 .
    AK295468 mRNA. Translation: BAH12078.1 .
    AK296615 mRNA. Translation: BAH12400.1 .
    AK313135 mRNA. Translation: BAG35954.1 .
    CR542034 mRNA. Translation: CAG46831.1 .
    CR542064 mRNA. Translation: CAG46861.1 .
    BT019444 mRNA. Translation: AAV38251.1 .
    BX640835 mRNA. Translation: CAE45908.1 .
    AK223631 mRNA. Translation: BAD97351.1 . Different initiation.
    AC009686 Genomic DNA. No translation available.
    AC018952 Genomic DNA. No translation available.
    AC036214 Genomic DNA. No translation available.
    AC104212 Genomic DNA. No translation available.
    CH471068 Genomic DNA. Translation: EAW87074.1 .
    BC018117 mRNA. Translation: AAH18117.1 .
    CCDSi CCDS34912.1. [P55327-1 ]
    CCDS47879.1. [P55327-4 ]
    CCDS55249.1. [P55327-2 ]
    PIRi I38910.
    RefSeqi NP_001020423.1. NM_001025252.2. [P55327-1 ]
    NP_001020424.1. NM_001025253.2. [P55327-4 ]
    NP_001274069.1. NM_001287140.1. [P55327-6 ]
    NP_001274071.1. NM_001287142.1. [P55327-5 ]
    NP_001274072.1. NM_001287143.1. [P55327-7 ]
    NP_001274073.1. NM_001287144.1.
    NP_005070.1. NM_005079.3. [P55327-2 ]
    UniGenei Hs.368433.

    3D structure databases

    ProteinModelPortali P55327.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 113016. 20 interactions.
    IntActi P55327. 9 interactions.
    MINTi MINT-3021043.
    STRINGi 9606.ENSP00000368391.

    PTM databases

    PhosphoSitei P55327.

    Polymorphism databases

    DMDMi 215273966.

    Proteomic databases

    MaxQBi P55327.
    PaxDbi P55327.
    PRIDEi P55327.

    Protocols and materials databases

    DNASUi 7163.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000379096 ; ENSP00000368390 ; ENSG00000076554 . [P55327-2 ]
    ENST00000379097 ; ENSP00000368391 ; ENSG00000076554 . [P55327-1 ]
    ENST00000448733 ; ENSP00000410222 ; ENSG00000076554 . [P55327-5 ]
    ENST00000517427 ; ENSP00000429351 ; ENSG00000076554 . [P55327-7 ]
    ENST00000517462 ; ENSP00000429708 ; ENSG00000076554 . [P55327-8 ]
    ENST00000518937 ; ENSP00000429915 ; ENSG00000076554 . [P55327-4 ]
    ENST00000520527 ; ENSP00000429309 ; ENSG00000076554 . [P55327-6 ]
    GeneIDi 7163.
    KEGGi hsa:7163.
    UCSCi uc003ybr.1. human. [P55327-1 ]
    uc003ybs.1. human. [P55327-4 ]
    uc003ybt.1. human. [P55327-2 ]

    Organism-specific databases

    CTDi 7163.
    GeneCardsi GC08M080870.
    H-InvDB HIX0152680.
    HGNCi HGNC:12005. TPD52.
    HPAi HPA028427.
    MIMi 604068. gene.
    neXtProti NX_P55327.
    PharmGKBi PA36686.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG251958.
    HOVERGENi HBG058643.
    InParanoidi P55327.
    OMAi MDFYEDY.
    OrthoDBi EOG744TBQ.
    PhylomeDBi P55327.
    TreeFami TF317562.

    Enzyme and pathway databases

    Reactomei REACT_19400. Golgi Associated Vesicle Biogenesis.

    Miscellaneous databases

    ChiTaRSi TPD52. human.
    GeneWikii TPD52.
    GenomeRNAii 7163.
    NextBioi 28030.
    PROi P55327.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P55327.
    Bgeei P55327.
    CleanExi HS_TPD52.
    Genevestigatori P55327.

    Family and domain databases

    InterProi IPR007327. TPD52.
    [Graphical view ]
    PANTHERi PTHR19307. PTHR19307. 1 hit.
    Pfami PF04201. TPD52. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "A screening method to identify genes commonly overexpressed in carcinomas and the identification of a novel complementary DNA sequence."
      Byrne J.A., Tomasetto C., Garnier J.-M., Rouyer N., Mattei M.-G., Bellocq J.-P., Rio M.C., Basset P.
      Cancer Res. 55:2896-2903(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
      Tissue: Mammary carcinoma.
    2. "Isolation and characterization of a novel gene expressed in multiple cancers."
      Chen S.-L., Maroulakou I.G., Green J.E., Romano-Spica V., Modi W., Lautenberger J., Bhat N.K.
      Oncogene 12:741-751(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE, ALTERNATIVE SPLICING.
      Tissue: Lung tumor.
    3. "PrLZ, a novel prostate-specific and androgen-responsive gene of the TPD52 family, amplified in chromosome 8q21.1 and overexpressed in human prostate cancer."
      Wang R., Xu J., Saramaki O., Visakorpi T., Sutherland W.M., Zhou J., Sen B., Lim S.D., Mabjeesh N., Amin M., Dong J.T., Petros J.A., Nelson P.S., Marshall F.F., Zhau H.E., Chung L.W.
      Cancer Res. 64:1589-1594(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    4. "Transcription variants of the prostate-specific PrLZ gene and their interaction with 14-3-3 proteins."
      Wang R., He H., Sun X., Xu J., Marshall F.F., Zhau H., Chung L.W., Fu H., He D.
      Biochem. Biophys. Res. Commun. 389:455-460(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 5; 6; 7 AND 8), ALTERNATIVE SPLICING, INTERACTION WITH 14-3-3 PROTEINS.
    5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 4).
      Tissue: Colon, Hippocampus and Tongue.
    6. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
      Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
      Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    7. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
      Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
      Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Rectum tumor.
    9. Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
      Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Spleen.
    10. "DNA sequence and analysis of human chromosome 8."
      Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T.
      , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.
      Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    11. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    12. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Skin.
    13. "Identification of homo- and heteromeric interactions between members of the breast carcinoma-associated D52 protein family using the yeast two-hybrid system."
      Byrne J.A., Nourse C.R., Basset P., Gunning P.
      Oncogene 16:873-881(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION.
    14. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
      Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
      Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    15. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-171; THR-173 AND SER-223, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    16. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-176, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    17. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    18. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-176, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiTPD52_HUMAN
    AccessioniPrimary (citable) accession number: P55327
    Secondary accession number(s): B7Z414
    , C9J502, D0UFD1, D0UFD2, D0UFD3, D0UFD4, D0UFD5, E5RKB4, Q13056, Q53EK8, Q6FGP3, Q6FGS3, Q86YZ2, Q9UCX8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 1, 1996
    Last sequence update: November 25, 2008
    Last modified: October 1, 2014
    This is version 127 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 8
      Human chromosome 8: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3