Reviewed,
UniProtKB/Swiss-Prot P55327 (TPD52_HUMAN)
Last modified
November 3, 2009.
Version 79.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Tumor protein D52 Alternative name(s): Protein N8 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Complete proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 224 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Subunit structure | Forms homodimer or heterodimer with other members of the family. |
| Tissue specificity | Isoform 2 is expressed in colon, breast, prostate, pancreas and kidney tumor cell lines. Isoform 2 is expressed at high levels in kidney, prostate, brain, small intestine and pancreas, at moderate levels in placenta and colon, at low levels in lung, liver and heart, and at very low levels in spleen, thymus, peripheral mononuclear blood cells, testis and ovary. Ref.2 |
| Developmental stage | Isoform 2 is expressed at lower levels in fetal brain and kidney than in adult brain and kidney. Ref.2 |
| Sequence similarities | Belongs to the TPD52 family. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil |
| PTM | Phosphoprotein |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | B cell differentiation Inferred from expression pattern. Source: UniProtKB anatomical structure morphogenesis Ref.2Traceable author statement. Source: ProtInc secretionTraceable author statement. Source: UniProtKB |
| Cellular component | endoplasmic reticulum Inferred from direct assay. Source: UniProtKB perinuclear region of cytoplasmInferred from direct assay. Source: UniProtKB |
| Molecular function | calcium ion binding Inferred from direct assay. Source: UniProtKB protein heterodimerization activity Ref.12Inferred from direct assay. Source: UniProtKB protein homodimerization activity Ref.12Inferred from direct assay. Source: UniProtKB |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| itself | 2 | EBI-782581,EBI-782581 | ||
| Tpd52 | Q62393 | 1 | EBI-782581,EBI-782591 | From a different organism. |
| TPD52L1 | Q16890 | 2 | EBI-782581,EBI-717470 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P55327-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P55327-2) The sequence of this isoform differs from the canonical sequence as follows: 1-46: MDCREMDLYEDYQSPFDFDAGVNKSYLYLSPSGNSSPPGSPTLQKF → MDRGEQ | ||||||
| Isoform 3 (identifier: P55327-3) Also known as: N8L; The sequence of this isoform differs from the canonical sequence as follows: 1-46: MDCREMDLYE...PPGSPTLQKF → MTPRESAPGR...RAGDMDRGEQ |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 224 | 224 | Tumor protein D52 | PRO_0000185738 | |||||
Regions | |||||||||
| Coiled coil | 62 – 114 | 53 | Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 171 | 1 | Phosphoserine Ref.13 Ref.14 Ref.15 Ref.16 | ||||||
| Modified residue | 173 | 1 | Phosphothreonine Ref.14 Ref.15 Ref.16 | ||||||
| Modified residue | 176 | 1 | Phosphoserine Ref.14 Ref.16 | ||||||
| Modified residue | 223 | 1 | Phosphoserine Ref.16 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 46 | 46 | MDCRE…TLQKF → MDRGEQ in isoform 2. | VSP_035751 | |||||
| Alternative sequence | 1 – 46 | 46 | MDCRE…TLQKF → MTPRESAPGRGRAAPPRPTP LGVGTSRESPAEARRSSARR GGRSEPGRAAGGGAAEDTRR RAGDMDRGEQ in isoform 3. | VSP_037378 | |||||
Experimental info | |||||||||
| Sequence conflict | 74 | 1 | E → K in BAD97351. Ref.8 | ||||||
| Sequence conflict | 165 | 1 | L → P in CAG46831. Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A screening method to identify genes commonly overexpressed in carcinomas and the identification of a novel complementary DNA sequence." Byrne J.A., Tomasetto C., Garnier J.-M., Rouyer N., Mattei M.-G., Bellocq J.-P., Rio M.C., Basset P. Cancer Res. 55:2896-2903(1995) [PubMed: 7796418] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Tissue: Mammary carcinoma. |
| [2] | "Isolation and characterization of a novel gene expressed in multiple cancers." Chen S.-L., Maroulakou I.G., Green J.E., Romano-Spica V., Modi W., Lautenberger J., Bhat N.K. Oncogene 12:741-751(1996) [PubMed: 8632896] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE, ALTERNATIVE SPLICING. Tissue: Lung tumor. |
| [3] | "PrLZ, a novel prostate-specific and androgen-responsive gene of the TPD52 family, amplified in chromosome 8q21.1 and overexpressed in human prostate cancer." Wang R., Xu J., Saramaki O., Visakorpi T., Sutherland W.M., Zhou J., Sen B., Lim S.D., Mabjeesh N., Amin M., Dong J.T., Petros J.A., Nelson P.S., Marshall F.F., Zhau H.E., Chung L.W. Cancer Res. 64:1589-1594(2004) [PubMed: 14996714] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Colon and Tongue. |
| [5] | "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [6] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [7] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Rectum tumor. |
| [8] | Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S. Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Spleen. |
| [9] | "DNA sequence and analysis of human chromosome 8." Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. Lander E.S.Nature 439:331-335(2006) [PubMed: 16421571] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [10] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [11] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Skin. |
| [12] | "Identification of homo- and heteromeric interactions between members of the breast carcinoma-associated D52 protein family using the yeast two-hybrid system." Byrne J.A., Nourse C.R., Basset P., Gunning P. Oncogene 16:873-881(1998) [PubMed: 9484778] [Abstract] Cited for: INTERACTION. |
| [13] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed: 17081983] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-171, MASS SPECTROMETRY. Tissue: Epithelium. |
| [14] | "Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry." Molina H., Horn D.M., Tang N., Mathivanan S., Pandey A. Proc. Natl. Acad. Sci. U.S.A. 104:2199-2204(2007) [PubMed: 17287340] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-171; THR-173 AND SER-176, MASS SPECTROMETRY. |
| [15] | "Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column." Imami K., Sugiyama N., Kyono Y., Tomita M., Ishihama Y. Anal. Sci. 24:161-166(2008) [PubMed: 18187866] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-171 AND THR-173, MASS SPECTROMETRY. |
| [16] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-171; THR-173; SER-176 AND SER-223, MASS SPECTROMETRY. |
| [17] | Colinge J., Superti-Furga G., Bennett K.L. Submitted (OCT-2008) to UniProtKB Cited for: IDENTIFICATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| U18914 mRNA. Translation: AAC50183.1. S82081 mRNA. Translation: AAB36475.1. AF202897 mRNA. Translation: AAO22156.1. AK296615 mRNA. Translation: BAH12400.1. AK313135 mRNA. Translation: BAG35954.1. CR542034 mRNA. Translation: CAG46831.1. CR542064 mRNA. Translation: CAG46861.1. BT019444 mRNA. Translation: AAV38251.1. BX640835 mRNA. Translation: CAE45908.1. AK223631 mRNA. Translation: BAD97351.1. Different initiation. AC009686 Genomic DNA. No translation available. CH471068 Genomic DNA. Translation: EAW87074.1. BC018117 mRNA. Translation: AAH18117.1. | |
| IPI | IPI00619958. IPI00873344. IPI00896474. |
| PIR | I38910. |
| RefSeq | NP_001020423.1. NP_001020424.1. NP_005070.1. |
| UniGene | Hs.368433 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P55327. 8 interactions. |
| STRING | P55327. |
PTM databases | |
| PhosphoSite | P55327. |
Proteomic databases | |
| PRIDE | P55327. |
Genome annotation databases | |
| Ensembl | ENST00000379096; ENSP00000368390; ENSG00000076554; Homo sapiens. [Genome view] ENST00000379097; ENSP00000368391; ENSG00000076554; Homo sapiens. [Genome view] ENST00000425513; ENSP00000394141; ENSG00000076554; Homo sapiens. [Genome view] ENST00000448733; ENSP00000410222; ENSG00000076554; Homo sapiens. [Genome view] |
| GeneID | 7163. |
| KEGG | hsa:7163. |
| UCSC | uc003ybr.1. human. uc003ybt.1. human. |
Organism-specific databases | |
| CTD | 7163. |
| GeneCards | GC08M081110. |
| H-InvDB | HIX0007611. |
| HGNC | HGNC:12005. TPD52. |
| MIM | 604068. gene. |
| PharmGKB | PA36686. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | P55327. |
| OMA | DEPVEDY. |
Enzyme and pathway databases | |
| Reactome | REACT_11123. Membrane Trafficking. |
Gene expression databases | |
| ArrayExpress | P55327. |
| Bgee | P55327. |
| CleanEx | HS_TPD52. |
| Genevestigator | P55327. |
| GermOnline | ENSG00000076554. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR007327. TPD52. [Graphical view] |
| PANTHER | PTHR19307. TPD52. 1 hit. |
| Pfam | PF04201. TPD52. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 28030. |
| SOURCE | Search... |
Entry information
| Entry name | TPD52_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P55327 Secondary accession number(s): B7Z414 Q9UCX8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


