Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P55327

- TPD52_HUMAN

UniProt

P55327 - TPD52_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Tumor protein D52

Gene

TPD52

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  1. calcium ion binding Source: UniProtKB
  2. protein heterodimerization activity Source: UniProtKB
  3. protein homodimerization activity Source: UniProtKB

GO - Biological processi

  1. anatomical structure morphogenesis Source: ProtInc
  2. B cell differentiation Source: UniProtKB
  3. positive regulation of cell proliferation Source: Ensembl
  4. secretion Source: UniProtKB
Complete GO annotation...

Enzyme and pathway databases

ReactomeiREACT_19400. Golgi Associated Vesicle Biogenesis.

Names & Taxonomyi

Protein namesi
Recommended name:
Tumor protein D52
Alternative name(s):
Protein N8
Gene namesi
Name:TPD52
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 8

Organism-specific databases

HGNCiHGNC:12005. TPD52.

Subcellular locationi

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB
  2. endoplasmic reticulum Source: UniProtKB
  3. perinuclear region of cytoplasm Source: UniProtKB
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA36686.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 224224Tumor protein D52PRO_0000185738Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei171 – 1711Phosphoserine1 Publication
Modified residuei173 – 1731Phosphothreonine1 Publication
Modified residuei176 – 1761Phosphoserine2 Publications
Modified residuei223 – 2231Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiP55327.
PaxDbiP55327.
PRIDEiP55327.

PTM databases

PhosphoSiteiP55327.

Expressioni

Tissue specificityi

Isoform 2 is expressed in colon, breast, prostate, pancreas and kidney tumor cell lines. Isoform 2 is expressed at high levels in kidney, prostate, brain, small intestine and pancreas, at moderate levels in placenta and colon, at low levels in lung, liver and heart, and at very low levels in spleen, thymus, peripheral mononuclear blood cells, testis and ovary.1 Publication

Developmental stagei

Isoform 2 is expressed at lower levels in fetal brain and kidney than in adult brain and kidney.1 Publication

Gene expression databases

BgeeiP55327.
CleanExiHS_TPD52.
ExpressionAtlasiP55327. baseline and differential.
GenevestigatoriP55327.

Organism-specific databases

HPAiHPA028427.

Interactioni

Subunit structurei

Forms a homodimer or heterodimer with other members of the family. All isoforms interact with several 14-3-3 proteins.

Binary interactionsi

WithEntry#Exp.IntActNotes
Tpd52Q623932EBI-782581,EBI-782591From a different organism.
TPD52L1Q168903EBI-782581,EBI-717470

Protein-protein interaction databases

BioGridi113016. 21 interactions.
IntActiP55327. 9 interactions.
MINTiMINT-3021043.
STRINGi9606.ENSP00000368391.

Structurei

3D structure databases

ProteinModelPortaliP55327.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili62 – 11453Sequence AnalysisAdd
BLAST

Sequence similaritiesi

Belongs to the TPD52 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiNOG251958.
GeneTreeiENSGT00390000015988.
HOVERGENiHBG058643.
InParanoidiP55327.
OMAiMDFYEDY.
OrthoDBiEOG744TBQ.
PhylomeDBiP55327.
TreeFamiTF317562.

Family and domain databases

InterProiIPR007327. TPD52.
[Graphical view]
PANTHERiPTHR19307. PTHR19307. 1 hit.
PfamiPF04201. TPD52. 1 hit.
[Graphical view]

Sequences (8)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P55327-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDCREMDLYE DYQSPFDFDA GVNKSYLYLS PSGNSSPPGS PTLQKFGLLR
60 70 80 90 100
TDPVPEEGED VAATISATET LSEEEQEELR RELAKVEEEI QTLSQVLAAK
110 120 130 140 150
EKHLAEIKRK LGINSLQELK QNIAKGWQDV TATSAYKKTS ETLSQAGQKA
160 170 180 190 200
SAAFSSVGSV ITKKLEDVKN SPTFKSFEEK VENLKSKVGG TKPAGGDFGE
210 220
VLNSAANASA TTTEPLPEKT QESL
Length:224
Mass (Da):24,327
Last modified:November 25, 2008 - v2
Checksum:i4C8183C5914BB976
GO
Isoform 2 (identifier: P55327-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-46: MDCREMDLYEDYQSPFDFDAGVNKSYLYLSPSGNSSPPGSPTLQKF → MDRGEQ

Show »
Length:184
Mass (Da):19,863
Checksum:i4821EC86D1C3339D
GO
Isoform 3 (identifier: P55327-3) [UniParc]FASTAAdd to Basket

Also known as: N8L

The sequence of this isoform differs from the canonical sequence as follows:
     1-46: MDCREMDLYE...PPGSPTLQKF → MTPRESAPGR...RAGDMDRGEQ

Show »
Length:248
Mass (Da):26,382
Checksum:iB7D203C4941A02B2
GO
Isoform 4 (identifier: P55327-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-46: MDCREMDLYEDYQSPFDFDAGVNKSYLYLSPSGNSSPPGSPTLQKF → MDRGEQ
     169-169: K → KLQAFSHSFSIRSIQHSISMPAMR

Note: No experimental confirmation available.

Show »
Length:207
Mass (Da):22,477
Checksum:i29027F1706989362
GO
Isoform 5 (identifier: P55327-5) [UniParc]FASTAAdd to Basket

Also known as: PrLZ-238

The sequence of this isoform differs from the canonical sequence as follows:
     168-169: VK → VNIRSIQHSISMPAMR

Show »
Length:238
Mass (Da):25,922
Checksum:i8E02245A52BF64C7
GO
Isoform 6 (identifier: P55327-6) [UniParc]FASTAAdd to Basket

Also known as: PrLZ-247

The sequence of this isoform differs from the canonical sequence as follows:
     169-169: K → KLQAFSHSFSIRSIQHSISMPAMR

Show »
Length:247
Mass (Da):26,941
Checksum:iF9526200A91B6ABB
GO
Isoform 7 (identifier: P55327-7) [UniParc]FASTAAdd to Basket

Also known as: PrLZ-233

The sequence of this isoform differs from the canonical sequence as follows:
     169-169: K → KLQAFSHSFR

Show »
Length:233
Mass (Da):25,401
Checksum:iA722640EFE14A677
GO
Isoform 8 (identifier: P55327-8) [UniParc]FASTAAdd to Basket

Also known as: PrLZ-151

The sequence of this isoform differs from the canonical sequence as follows:
     136-224: YKKTSETLSQ...PLPEKTQESL → RSKLLAAETELLCLLY

Note: Interacts only with YWHAB and YWHAQ among 14-3-3 proteins.

Show »
Length:151
Mass (Da):16,853
Checksum:i5270A0BAF1F81B70
GO

Sequence cautioni

The sequence BAD97351.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti74 – 741E → K in BAD97351. 1 PublicationCurated
Sequence conflicti165 – 1651L → P in CAG46831. 1 PublicationCurated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti52 – 521D → Y.
Corresponds to variant rs35099105 [ dbSNP | Ensembl ].
VAR_061860

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4646MDCRE…TLQKF → MDRGEQ in isoform 2 and isoform 4. 7 PublicationsVSP_035751Add
BLAST
Alternative sequencei1 – 4646MDCRE…TLQKF → MTPRESAPGRGRAAPPRPTP LGVGTSRESPAEARRSSARR GGRSEPGRAAGGGAAEDTRR RAGDMDRGEQ in isoform 3. 1 PublicationVSP_037378Add
BLAST
Alternative sequencei136 – 22489YKKTS…TQESL → RSKLLAAETELLCLLY in isoform 8. 1 PublicationVSP_047718Add
BLAST
Alternative sequencei168 – 1692VK → VNIRSIQHSISMPAMR in isoform 5. 1 PublicationVSP_047719
Alternative sequencei169 – 1691K → KLQAFSHSFSIRSIQHSISM PAMR in isoform 4 and isoform 6. 2 PublicationsVSP_043510
Alternative sequencei169 – 1691K → KLQAFSHSFR in isoform 7. 1 PublicationVSP_047720

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U18914 mRNA. Translation: AAC50183.1.
S82081 mRNA. Translation: AAB36475.1.
AF202897 mRNA. Translation: AAO22156.1.
GQ499324 mRNA. Translation: ACY08776.1.
GQ499325 mRNA. Translation: ACY08777.1.
GQ499326 mRNA. Translation: ACY08778.1.
GQ499327 mRNA. Translation: ACY08779.1.
GQ499328 mRNA. Translation: ACY08780.1.
AK295468 mRNA. Translation: BAH12078.1.
AK296615 mRNA. Translation: BAH12400.1.
AK313135 mRNA. Translation: BAG35954.1.
CR542034 mRNA. Translation: CAG46831.1.
CR542064 mRNA. Translation: CAG46861.1.
BT019444 mRNA. Translation: AAV38251.1.
BX640835 mRNA. Translation: CAE45908.1.
AK223631 mRNA. Translation: BAD97351.1. Different initiation.
AC009686 Genomic DNA. No translation available.
AC018952 Genomic DNA. No translation available.
AC036214 Genomic DNA. No translation available.
AC104212 Genomic DNA. No translation available.
CH471068 Genomic DNA. Translation: EAW87074.1.
BC018117 mRNA. Translation: AAH18117.1.
CCDSiCCDS34912.1. [P55327-1]
CCDS47879.1. [P55327-4]
CCDS55249.1. [P55327-2]
CCDS75757.1. [P55327-5]
CCDS75758.1. [P55327-7]
CCDS75759.1. [P55327-6]
PIRiI38910.
RefSeqiNP_001020423.1. NM_001025252.2. [P55327-1]
NP_001020424.1. NM_001025253.2. [P55327-4]
NP_001274069.1. NM_001287140.1. [P55327-6]
NP_001274071.1. NM_001287142.1. [P55327-5]
NP_001274072.1. NM_001287143.1. [P55327-7]
NP_001274073.1. NM_001287144.1.
NP_005070.1. NM_005079.3. [P55327-2]
UniGeneiHs.368433.

Genome annotation databases

EnsembliENST00000379096; ENSP00000368390; ENSG00000076554. [P55327-2]
ENST00000379097; ENSP00000368391; ENSG00000076554. [P55327-1]
ENST00000448733; ENSP00000410222; ENSG00000076554. [P55327-5]
ENST00000517427; ENSP00000429351; ENSG00000076554. [P55327-7]
ENST00000517462; ENSP00000429708; ENSG00000076554. [P55327-8]
ENST00000518937; ENSP00000429915; ENSG00000076554. [P55327-4]
ENST00000520527; ENSP00000429309; ENSG00000076554. [P55327-6]
GeneIDi7163.
KEGGihsa:7163.
UCSCiuc003ybr.1. human. [P55327-1]
uc003ybs.1. human. [P55327-4]
uc003ybt.1. human. [P55327-2]

Polymorphism databases

DMDMi215273966.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U18914 mRNA. Translation: AAC50183.1 .
S82081 mRNA. Translation: AAB36475.1 .
AF202897 mRNA. Translation: AAO22156.1 .
GQ499324 mRNA. Translation: ACY08776.1 .
GQ499325 mRNA. Translation: ACY08777.1 .
GQ499326 mRNA. Translation: ACY08778.1 .
GQ499327 mRNA. Translation: ACY08779.1 .
GQ499328 mRNA. Translation: ACY08780.1 .
AK295468 mRNA. Translation: BAH12078.1 .
AK296615 mRNA. Translation: BAH12400.1 .
AK313135 mRNA. Translation: BAG35954.1 .
CR542034 mRNA. Translation: CAG46831.1 .
CR542064 mRNA. Translation: CAG46861.1 .
BT019444 mRNA. Translation: AAV38251.1 .
BX640835 mRNA. Translation: CAE45908.1 .
AK223631 mRNA. Translation: BAD97351.1 . Different initiation.
AC009686 Genomic DNA. No translation available.
AC018952 Genomic DNA. No translation available.
AC036214 Genomic DNA. No translation available.
AC104212 Genomic DNA. No translation available.
CH471068 Genomic DNA. Translation: EAW87074.1 .
BC018117 mRNA. Translation: AAH18117.1 .
CCDSi CCDS34912.1. [P55327-1 ]
CCDS47879.1. [P55327-4 ]
CCDS55249.1. [P55327-2 ]
CCDS75757.1. [P55327-5 ]
CCDS75758.1. [P55327-7 ]
CCDS75759.1. [P55327-6 ]
PIRi I38910.
RefSeqi NP_001020423.1. NM_001025252.2. [P55327-1 ]
NP_001020424.1. NM_001025253.2. [P55327-4 ]
NP_001274069.1. NM_001287140.1. [P55327-6 ]
NP_001274071.1. NM_001287142.1. [P55327-5 ]
NP_001274072.1. NM_001287143.1. [P55327-7 ]
NP_001274073.1. NM_001287144.1.
NP_005070.1. NM_005079.3. [P55327-2 ]
UniGenei Hs.368433.

3D structure databases

ProteinModelPortali P55327.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 113016. 21 interactions.
IntActi P55327. 9 interactions.
MINTi MINT-3021043.
STRINGi 9606.ENSP00000368391.

PTM databases

PhosphoSitei P55327.

Polymorphism databases

DMDMi 215273966.

Proteomic databases

MaxQBi P55327.
PaxDbi P55327.
PRIDEi P55327.

Protocols and materials databases

DNASUi 7163.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000379096 ; ENSP00000368390 ; ENSG00000076554 . [P55327-2 ]
ENST00000379097 ; ENSP00000368391 ; ENSG00000076554 . [P55327-1 ]
ENST00000448733 ; ENSP00000410222 ; ENSG00000076554 . [P55327-5 ]
ENST00000517427 ; ENSP00000429351 ; ENSG00000076554 . [P55327-7 ]
ENST00000517462 ; ENSP00000429708 ; ENSG00000076554 . [P55327-8 ]
ENST00000518937 ; ENSP00000429915 ; ENSG00000076554 . [P55327-4 ]
ENST00000520527 ; ENSP00000429309 ; ENSG00000076554 . [P55327-6 ]
GeneIDi 7163.
KEGGi hsa:7163.
UCSCi uc003ybr.1. human. [P55327-1 ]
uc003ybs.1. human. [P55327-4 ]
uc003ybt.1. human. [P55327-2 ]

Organism-specific databases

CTDi 7163.
GeneCardsi GC08M080870.
H-InvDB HIX0152680.
HGNCi HGNC:12005. TPD52.
HPAi HPA028427.
MIMi 604068. gene.
neXtProti NX_P55327.
PharmGKBi PA36686.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG251958.
GeneTreei ENSGT00390000015988.
HOVERGENi HBG058643.
InParanoidi P55327.
OMAi MDFYEDY.
OrthoDBi EOG744TBQ.
PhylomeDBi P55327.
TreeFami TF317562.

Enzyme and pathway databases

Reactomei REACT_19400. Golgi Associated Vesicle Biogenesis.

Miscellaneous databases

ChiTaRSi TPD52. human.
GeneWikii TPD52.
GenomeRNAii 7163.
NextBioi 28030.
PROi P55327.
SOURCEi Search...

Gene expression databases

Bgeei P55327.
CleanExi HS_TPD52.
ExpressionAtlasi P55327. baseline and differential.
Genevestigatori P55327.

Family and domain databases

InterProi IPR007327. TPD52.
[Graphical view ]
PANTHERi PTHR19307. PTHR19307. 1 hit.
Pfami PF04201. TPD52. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "A screening method to identify genes commonly overexpressed in carcinomas and the identification of a novel complementary DNA sequence."
    Byrne J.A., Tomasetto C., Garnier J.-M., Rouyer N., Mattei M.-G., Bellocq J.-P., Rio M.C., Basset P.
    Cancer Res. 55:2896-2903(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Tissue: Mammary carcinoma.
  2. "Isolation and characterization of a novel gene expressed in multiple cancers."
    Chen S.-L., Maroulakou I.G., Green J.E., Romano-Spica V., Modi W., Lautenberger J., Bhat N.K.
    Oncogene 12:741-751(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE, ALTERNATIVE SPLICING.
    Tissue: Lung tumor.
  3. "PrLZ, a novel prostate-specific and androgen-responsive gene of the TPD52 family, amplified in chromosome 8q21.1 and overexpressed in human prostate cancer."
    Wang R., Xu J., Saramaki O., Visakorpi T., Sutherland W.M., Zhou J., Sen B., Lim S.D., Mabjeesh N., Amin M., Dong J.T., Petros J.A., Nelson P.S., Marshall F.F., Zhau H.E., Chung L.W.
    Cancer Res. 64:1589-1594(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  4. "Transcription variants of the prostate-specific PrLZ gene and their interaction with 14-3-3 proteins."
    Wang R., He H., Sun X., Xu J., Marshall F.F., Zhau H., Chung L.W., Fu H., He D.
    Biochem. Biophys. Res. Commun. 389:455-460(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 5; 6; 7 AND 8), ALTERNATIVE SPLICING, INTERACTION WITH 14-3-3 PROTEINS.
  5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 4).
    Tissue: Colon, Hippocampus and Tongue.
  6. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
    Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
    Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  7. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
    Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
    Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Rectum tumor.
  9. Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
    Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Spleen.
  10. "DNA sequence and analysis of human chromosome 8."
    Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T.
    , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.
    Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  11. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  12. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Skin.
  13. "Identification of homo- and heteromeric interactions between members of the breast carcinoma-associated D52 protein family using the yeast two-hybrid system."
    Byrne J.A., Nourse C.R., Basset P., Gunning P.
    Oncogene 16:873-881(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION.
  14. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  15. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-171; THR-173 AND SER-223, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  16. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-176, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  17. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  18. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-176, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiTPD52_HUMAN
AccessioniPrimary (citable) accession number: P55327
Secondary accession number(s): B7Z414
, C9J502, D0UFD1, D0UFD2, D0UFD3, D0UFD4, D0UFD5, E5RKB4, Q13056, Q53EK8, Q6FGP3, Q6FGS3, Q86YZ2, Q9UCX8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: November 25, 2008
Last modified: October 29, 2014
This is version 128 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3