Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tumor protein D52

Gene

TPD52

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  • calcium ion binding Source: UniProtKB
  • protein heterodimerization activity Source: UniProtKB
  • protein homodimerization activity Source: UniProtKB

GO - Biological processi

  • anatomical structure morphogenesis Source: ProtInc
  • B cell differentiation Source: UniProtKB
  • secretion Source: UniProtKB
Complete GO annotation...

Enzyme and pathway databases

BioCyciZFISH:ENSG00000076554-MONOMER.
ReactomeiR-HSA-432722. Golgi Associated Vesicle Biogenesis.
SIGNORiP55327.

Names & Taxonomyi

Protein namesi
Recommended name:
Tumor protein D52
Alternative name(s):
Protein N8
Gene namesi
Name:TPD52
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 8

Organism-specific databases

HGNCiHGNC:12005. TPD52.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: UniProtKB
  • endoplasmic reticulum Source: UniProtKB
  • perinuclear region of cytoplasm Source: UniProtKB
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

DisGeNETi7163.
OpenTargetsiENSG00000076554.
PharmGKBiPA36686.

Polymorphism and mutation databases

BioMutaiTPD52.
DMDMi215273966.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001857381 – 224Tumor protein D52Add BLAST224

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei36PhosphoserineBy similarity1
Modified residuei40PhosphoserineBy similarity1
Modified residuei176PhosphoserineBy similarity1
Modified residuei223PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiP55327.
MaxQBiP55327.
PaxDbiP55327.
PeptideAtlasiP55327.
PRIDEiP55327.
TopDownProteomicsiP55327-2. [P55327-2]
P55327-4. [P55327-4]

PTM databases

iPTMnetiP55327.
PhosphoSitePlusiP55327.

Expressioni

Tissue specificityi

Isoform 2 is expressed in colon, breast, prostate, pancreas and kidney tumor cell lines. Isoform 2 is expressed at high levels in kidney, prostate, brain, small intestine and pancreas, at moderate levels in placenta and colon, at low levels in lung, liver and heart, and at very low levels in spleen, thymus, peripheral mononuclear blood cells, testis and ovary.1 Publication

Developmental stagei

Isoform 2 is expressed at lower levels in fetal brain and kidney than in adult brain and kidney.1 Publication

Gene expression databases

BgeeiENSG00000076554.
CleanExiHS_TPD52.
ExpressionAtlasiP55327. baseline and differential.
GenevisibleiP55327. HS.

Organism-specific databases

HPAiHPA028427.
HPA062167.

Interactioni

Subunit structurei

Forms a homodimer or heterodimer with other members of the family. All isoforms interact with several 14-3-3 proteins.

Binary interactionsi

WithEntry#Exp.IntActNotes
Tpd52Q623932EBI-782581,EBI-782591From a different organism.
TPD52L1Q168903EBI-782581,EBI-717470

GO - Molecular functioni

  • protein heterodimerization activity Source: UniProtKB
  • protein homodimerization activity Source: UniProtKB

Protein-protein interaction databases

BioGridi113016. 50 interactors.
IntActiP55327. 13 interactors.
MINTiMINT-3021043.
STRINGi9606.ENSP00000368391.

Structurei

3D structure databases

ProteinModelPortaliP55327.
SMRiP55327.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili62 – 114Sequence analysisAdd BLAST53

Sequence similaritiesi

Belongs to the TPD52 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG4010. Eukaryota.
ENOG4111M9H. LUCA.
GeneTreeiENSGT00390000015988.
HOGENOMiHOG000231968.
HOVERGENiHBG058643.
InParanoidiP55327.
OMAiMDFYEDY.
OrthoDBiEOG091G0MLN.
PhylomeDBiP55327.
TreeFamiTF317562.

Family and domain databases

InterProiIPR007327. TPD52.
[Graphical view]
PANTHERiPTHR19307. PTHR19307. 1 hit.
PfamiPF04201. TPD52. 1 hit.
[Graphical view]

Sequences (8)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P55327-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDCREMDLYE DYQSPFDFDA GVNKSYLYLS PSGNSSPPGS PTLQKFGLLR
60 70 80 90 100
TDPVPEEGED VAATISATET LSEEEQEELR RELAKVEEEI QTLSQVLAAK
110 120 130 140 150
EKHLAEIKRK LGINSLQELK QNIAKGWQDV TATSAYKKTS ETLSQAGQKA
160 170 180 190 200
SAAFSSVGSV ITKKLEDVKN SPTFKSFEEK VENLKSKVGG TKPAGGDFGE
210 220
VLNSAANASA TTTEPLPEKT QESL
Length:224
Mass (Da):24,327
Last modified:November 25, 2008 - v2
Checksum:i4C8183C5914BB976
GO
Isoform 2 (identifier: P55327-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-46: MDCREMDLYEDYQSPFDFDAGVNKSYLYLSPSGNSSPPGSPTLQKF → MDRGEQ

Show »
Length:184
Mass (Da):19,863
Checksum:i4821EC86D1C3339D
GO
Isoform 3 (identifier: P55327-3) [UniParc]FASTAAdd to basket
Also known as: N8L

The sequence of this isoform differs from the canonical sequence as follows:
     1-46: MDCREMDLYE...PPGSPTLQKF → MTPRESAPGR...RAGDMDRGEQ

Show »
Length:248
Mass (Da):26,382
Checksum:iB7D203C4941A02B2
GO
Isoform 4 (identifier: P55327-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-46: MDCREMDLYEDYQSPFDFDAGVNKSYLYLSPSGNSSPPGSPTLQKF → MDRGEQ
     169-169: K → KLQAFSHSFSIRSIQHSISMPAMR

Note: No experimental confirmation available.
Show »
Length:207
Mass (Da):22,477
Checksum:i29027F1706989362
GO
Isoform 5 (identifier: P55327-5) [UniParc]FASTAAdd to basket
Also known as: PrLZ-238

The sequence of this isoform differs from the canonical sequence as follows:
     168-169: VK → VNIRSIQHSISMPAMR

Show »
Length:238
Mass (Da):25,922
Checksum:i8E02245A52BF64C7
GO
Isoform 6 (identifier: P55327-6) [UniParc]FASTAAdd to basket
Also known as: PrLZ-247

The sequence of this isoform differs from the canonical sequence as follows:
     169-169: K → KLQAFSHSFSIRSIQHSISMPAMR

Show »
Length:247
Mass (Da):26,941
Checksum:iF9526200A91B6ABB
GO
Isoform 7 (identifier: P55327-7) [UniParc]FASTAAdd to basket
Also known as: PrLZ-233

The sequence of this isoform differs from the canonical sequence as follows:
     169-169: K → KLQAFSHSFR

Show »
Length:233
Mass (Da):25,401
Checksum:iA722640EFE14A677
GO
Isoform 8 (identifier: P55327-8) [UniParc]FASTAAdd to basket
Also known as: PrLZ-151

The sequence of this isoform differs from the canonical sequence as follows:
     136-224: YKKTSETLSQ...PLPEKTQESL → RSKLLAAETELLCLLY

Note: Interacts only with YWHAB and YWHAQ among 14-3-3 proteins.
Show »
Length:151
Mass (Da):16,853
Checksum:i5270A0BAF1F81B70
GO

Sequence cautioni

The sequence BAD97351 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti74E → K in BAD97351 (Ref. 9) Curated1
Sequence conflicti165L → P in CAG46831 (Ref. 6) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06186052D → Y.Corresponds to variant rs35099105dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0357511 – 46MDCRE…TLQKF → MDRGEQ in isoform 2 and isoform 4. 7 PublicationsAdd BLAST46
Alternative sequenceiVSP_0373781 – 46MDCRE…TLQKF → MTPRESAPGRGRAAPPRPTP LGVGTSRESPAEARRSSARR GGRSEPGRAAGGGAAEDTRR RAGDMDRGEQ in isoform 3. 1 PublicationAdd BLAST46
Alternative sequenceiVSP_047718136 – 224YKKTS…TQESL → RSKLLAAETELLCLLY in isoform 8. 1 PublicationAdd BLAST89
Alternative sequenceiVSP_047719168 – 169VK → VNIRSIQHSISMPAMR in isoform 5. 1 Publication2
Alternative sequenceiVSP_043510169K → KLQAFSHSFSIRSIQHSISM PAMR in isoform 4 and isoform 6. 2 Publications1
Alternative sequenceiVSP_047720169K → KLQAFSHSFR in isoform 7. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U18914 mRNA. Translation: AAC50183.1.
S82081 mRNA. Translation: AAB36475.1.
AF202897 mRNA. Translation: AAO22156.1.
GQ499324 mRNA. Translation: ACY08776.1.
GQ499325 mRNA. Translation: ACY08777.1.
GQ499326 mRNA. Translation: ACY08778.1.
GQ499327 mRNA. Translation: ACY08779.1.
GQ499328 mRNA. Translation: ACY08780.1.
AK295468 mRNA. Translation: BAH12078.1.
AK296615 mRNA. Translation: BAH12400.1.
AK313135 mRNA. Translation: BAG35954.1.
CR542034 mRNA. Translation: CAG46831.1.
CR542064 mRNA. Translation: CAG46861.1.
BT019444 mRNA. Translation: AAV38251.1.
BX640835 mRNA. Translation: CAE45908.1.
AK223631 mRNA. Translation: BAD97351.1. Different initiation.
AC009686 Genomic DNA. No translation available.
AC018952 Genomic DNA. No translation available.
AC036214 Genomic DNA. No translation available.
AC104212 Genomic DNA. No translation available.
CH471068 Genomic DNA. Translation: EAW87074.1.
BC018117 mRNA. Translation: AAH18117.1.
CCDSiCCDS34912.1. [P55327-1]
CCDS47879.1. [P55327-4]
CCDS55249.1. [P55327-2]
CCDS75757.1. [P55327-5]
CCDS75758.1. [P55327-7]
CCDS75759.1. [P55327-6]
PIRiI38910.
RefSeqiNP_001020423.1. NM_001025252.2. [P55327-1]
NP_001020424.1. NM_001025253.2. [P55327-4]
NP_001274069.1. NM_001287140.1. [P55327-6]
NP_001274071.1. NM_001287142.1. [P55327-5]
NP_001274072.1. NM_001287143.1. [P55327-7]
NP_001274073.1. NM_001287144.1.
NP_005070.1. NM_005079.3. [P55327-2]
UniGeneiHs.368433.

Genome annotation databases

EnsembliENST00000379096; ENSP00000368390; ENSG00000076554. [P55327-2]
ENST00000379097; ENSP00000368391; ENSG00000076554. [P55327-1]
ENST00000448733; ENSP00000410222; ENSG00000076554. [P55327-5]
ENST00000517427; ENSP00000429351; ENSG00000076554. [P55327-7]
ENST00000517462; ENSP00000429708; ENSG00000076554. [P55327-8]
ENST00000518937; ENSP00000429915; ENSG00000076554. [P55327-4]
ENST00000520527; ENSP00000429309; ENSG00000076554. [P55327-6]
GeneIDi7163.
KEGGihsa:7163.
UCSCiuc003ybr.3. human. [P55327-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U18914 mRNA. Translation: AAC50183.1.
S82081 mRNA. Translation: AAB36475.1.
AF202897 mRNA. Translation: AAO22156.1.
GQ499324 mRNA. Translation: ACY08776.1.
GQ499325 mRNA. Translation: ACY08777.1.
GQ499326 mRNA. Translation: ACY08778.1.
GQ499327 mRNA. Translation: ACY08779.1.
GQ499328 mRNA. Translation: ACY08780.1.
AK295468 mRNA. Translation: BAH12078.1.
AK296615 mRNA. Translation: BAH12400.1.
AK313135 mRNA. Translation: BAG35954.1.
CR542034 mRNA. Translation: CAG46831.1.
CR542064 mRNA. Translation: CAG46861.1.
BT019444 mRNA. Translation: AAV38251.1.
BX640835 mRNA. Translation: CAE45908.1.
AK223631 mRNA. Translation: BAD97351.1. Different initiation.
AC009686 Genomic DNA. No translation available.
AC018952 Genomic DNA. No translation available.
AC036214 Genomic DNA. No translation available.
AC104212 Genomic DNA. No translation available.
CH471068 Genomic DNA. Translation: EAW87074.1.
BC018117 mRNA. Translation: AAH18117.1.
CCDSiCCDS34912.1. [P55327-1]
CCDS47879.1. [P55327-4]
CCDS55249.1. [P55327-2]
CCDS75757.1. [P55327-5]
CCDS75758.1. [P55327-7]
CCDS75759.1. [P55327-6]
PIRiI38910.
RefSeqiNP_001020423.1. NM_001025252.2. [P55327-1]
NP_001020424.1. NM_001025253.2. [P55327-4]
NP_001274069.1. NM_001287140.1. [P55327-6]
NP_001274071.1. NM_001287142.1. [P55327-5]
NP_001274072.1. NM_001287143.1. [P55327-7]
NP_001274073.1. NM_001287144.1.
NP_005070.1. NM_005079.3. [P55327-2]
UniGeneiHs.368433.

3D structure databases

ProteinModelPortaliP55327.
SMRiP55327.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113016. 50 interactors.
IntActiP55327. 13 interactors.
MINTiMINT-3021043.
STRINGi9606.ENSP00000368391.

PTM databases

iPTMnetiP55327.
PhosphoSitePlusiP55327.

Polymorphism and mutation databases

BioMutaiTPD52.
DMDMi215273966.

Proteomic databases

EPDiP55327.
MaxQBiP55327.
PaxDbiP55327.
PeptideAtlasiP55327.
PRIDEiP55327.
TopDownProteomicsiP55327-2. [P55327-2]
P55327-4. [P55327-4]

Protocols and materials databases

DNASUi7163.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000379096; ENSP00000368390; ENSG00000076554. [P55327-2]
ENST00000379097; ENSP00000368391; ENSG00000076554. [P55327-1]
ENST00000448733; ENSP00000410222; ENSG00000076554. [P55327-5]
ENST00000517427; ENSP00000429351; ENSG00000076554. [P55327-7]
ENST00000517462; ENSP00000429708; ENSG00000076554. [P55327-8]
ENST00000518937; ENSP00000429915; ENSG00000076554. [P55327-4]
ENST00000520527; ENSP00000429309; ENSG00000076554. [P55327-6]
GeneIDi7163.
KEGGihsa:7163.
UCSCiuc003ybr.3. human. [P55327-1]

Organism-specific databases

CTDi7163.
DisGeNETi7163.
GeneCardsiTPD52.
H-InvDBHIX0152680.
HGNCiHGNC:12005. TPD52.
HPAiHPA028427.
HPA062167.
MIMi604068. gene.
neXtProtiNX_P55327.
OpenTargetsiENSG00000076554.
PharmGKBiPA36686.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4010. Eukaryota.
ENOG4111M9H. LUCA.
GeneTreeiENSGT00390000015988.
HOGENOMiHOG000231968.
HOVERGENiHBG058643.
InParanoidiP55327.
OMAiMDFYEDY.
OrthoDBiEOG091G0MLN.
PhylomeDBiP55327.
TreeFamiTF317562.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000076554-MONOMER.
ReactomeiR-HSA-432722. Golgi Associated Vesicle Biogenesis.
SIGNORiP55327.

Miscellaneous databases

ChiTaRSiTPD52. human.
GeneWikiiTPD52.
GenomeRNAii7163.
PROiP55327.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000076554.
CleanExiHS_TPD52.
ExpressionAtlasiP55327. baseline and differential.
GenevisibleiP55327. HS.

Family and domain databases

InterProiIPR007327. TPD52.
[Graphical view]
PANTHERiPTHR19307. PTHR19307. 1 hit.
PfamiPF04201. TPD52. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiTPD52_HUMAN
AccessioniPrimary (citable) accession number: P55327
Secondary accession number(s): B7Z414
, C9J502, D0UFD1, D0UFD2, D0UFD3, D0UFD4, D0UFD5, E5RKB4, Q13056, Q53EK8, Q6FGP3, Q6FGS3, Q86YZ2, Q9UCX8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: November 25, 2008
Last modified: November 30, 2016
This is version 150 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.