Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cadherin-13

Gene

CDH13

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. May act as a negative regulator of neural cell growth.1 Publication

GO - Molecular functioni

  • adiponectin binding Source: BHF-UCL
  • cadherin binding Source: BHF-UCL
  • calcium ion binding Source: InterPro
  • lipoprotein particle binding Source: UniProtKB
  • low-density lipoprotein particle binding Source: BHF-UCL

GO - Biological processi

  • adherens junction organization Source: Reactome
  • calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules Source: BHF-UCL
  • endothelial cell migration Source: BHF-UCL
  • homophilic cell adhesion via plasma membrane adhesion molecules Source: BHF-UCL
  • keratinocyte proliferation Source: BHF-UCL
  • lamellipodium assembly Source: BHF-UCL
  • localization within membrane Source: BHF-UCL
  • low-density lipoprotein particle mediated signaling Source: BHF-UCL
  • mitotic cell cycle Source: Ensembl
  • negative regulation of cell adhesion Source: BHF-UCL
  • negative regulation of cell proliferation Source: BHF-UCL
  • positive regulation of calcium-mediated signaling Source: BHF-UCL
  • positive regulation of cell-matrix adhesion Source: BHF-UCL
  • positive regulation of cell migration Source: BHF-UCL
  • positive regulation of endothelial cell proliferation Source: BHF-UCL
  • positive regulation of positive chemotaxis Source: BHF-UCL
  • positive regulation of smooth muscle cell proliferation Source: BHF-UCL
  • positive regulation of transcription from RNA polymerase II promoter Source: BHF-UCL
  • Rac protein signal transduction Source: BHF-UCL
  • regulation of endocytosis Source: BHF-UCL
  • regulation of epidermal growth factor receptor signaling pathway Source: BHF-UCL
  • Rho protein signal transduction Source: BHF-UCL
  • sprouting angiogenesis Source: BHF-UCL
Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Keywords - Ligandi

Calcium, Metal-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000140945-MONOMER.
ReactomeiR-HSA-418990. Adherens junctions interactions.
SIGNORiP55290.

Names & Taxonomyi

Protein namesi
Recommended name:
Cadherin-13
Alternative name(s):
Heart cadherin
Short name:
H-cadherin
P105
Truncated cadherin
Short name:
T-cad
Short name:
T-cadherin
Gene namesi
Name:CDH13
Synonyms:CDHH
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

HGNCiHGNC:1753. CDH13.

Subcellular locationi

GO - Cellular componenti

  • anchored component of membrane Source: UniProtKB-KW
  • caveola Source: BHF-UCL
  • cytoplasm Source: BHF-UCL
  • external side of plasma membrane Source: Ensembl
  • extracellular exosome Source: UniProtKB
  • extracellular space Source: BHF-UCL
  • focal adhesion Source: UniProtKB
  • neuron projection Source: BHF-UCL
  • perinuclear region of cytoplasm Source: Ensembl
  • plasma membrane Source: BHF-UCL
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi1012.
OpenTargetsiENSG00000140945.
PharmGKBiPA26287.

Polymorphism and mutation databases

BioMutaiCDH13.
DMDMi1705552.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 22Sequence analysisAdd BLAST22
PropeptideiPRO_000000379323 – 138Add BLAST116
ChainiPRO_0000003794139 – 693Cadherin-13Add BLAST555
PropeptideiPRO_0000003795694 – 713Removed in mature formCuratedAdd BLAST20

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi52N-linked (GlcNAc...)Sequence analysis1
Glycosylationi86N-linked (GlcNAc...)1 Publication1
Glycosylationi382N-linked (GlcNAc...)Sequence analysis1
Glycosylationi500N-linked (GlcNAc...)1 Publication1
Glycosylationi530N-linked (GlcNAc...)1 Publication1
Glycosylationi598N-linked (GlcNAc...)Sequence analysis1
Glycosylationi638N-linked (GlcNAc...)2 Publications1
Glycosylationi671N-linked (GlcNAc...)Sequence analysis1
Lipidationi693GPI-anchor amidated glycine1 Publication1

Keywords - PTMi

Cleavage on pair of basic residues, Glycoprotein, GPI-anchor, Lipoprotein

Proteomic databases

EPDiP55290.
MaxQBiP55290.
PeptideAtlasiP55290.
PRIDEiP55290.
TopDownProteomicsiP55290-1. [P55290-1]

PTM databases

iPTMnetiP55290.
PhosphoSitePlusiP55290.
SwissPalmiP55290.

Expressioni

Tissue specificityi

Highly expressed in heart. In the CNS, expressed in cerebral cortex, medulla, hippocampus, amygdala, thalamus and substantia nigra. No expression detected in cerebellum or spinal cord.2 Publications

Developmental stagei

Expressed at higher levels in adult brain than in developing brain.1 Publication

Gene expression databases

BgeeiENSG00000140945.
CleanExiHS_CDH13.
ExpressionAtlasiP55290. baseline and differential.

Organism-specific databases

HPAiCAB025863.
HPA001380.

Interactioni

Subunit structurei

By contrast to classical cadherins, homodimerization in trans is not mediated by cadherin EC1 domain strand-swapping, but instead through a homophilic adhesive interface which joins two elongated EC1-EC2 domains through a region near their Ca2+-binding sites to form a tetrahedral, X-like shape.By similarity

GO - Molecular functioni

  • adiponectin binding Source: BHF-UCL
  • cadherin binding Source: BHF-UCL

Protein-protein interaction databases

BioGridi107447. 28 interactors.
IntActiP55290. 9 interactors.
MINTiMINT-7004770.

Structurei

Secondary structure

1713
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi145 – 148Combined sources4
Beta strandi157 – 161Combined sources5
Beta strandi163 – 167Combined sources5
Beta strandi172 – 178Combined sources7
Turni179 – 181Combined sources3
Beta strandi182 – 184Combined sources3
Beta strandi187 – 190Combined sources4
Turni192 – 194Combined sources3
Beta strandi196 – 199Combined sources4
Turni205 – 207Combined sources3
Beta strandi209 – 218Combined sources10
Beta strandi224 – 236Combined sources13
Beta strandi238 – 241Combined sources4

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2V37NMR-A139-243[»]
ProteinModelPortaliP55290.
SMRiP55290.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP55290.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini139 – 245Cadherin 1PROSITE-ProRule annotationAdd BLAST107
Domaini246 – 363Cadherin 2PROSITE-ProRule annotationAdd BLAST118
Domaini364 – 477Cadherin 3PROSITE-ProRule annotationAdd BLAST114
Domaini478 – 585Cadherin 4PROSITE-ProRule annotationAdd BLAST108
Domaini584 – 694Cadherin 5PROSITE-ProRule annotationAdd BLAST111

Domaini

Three calcium ions are usually bound at the interface of each cadherin domain and rigidify the connections, imparting a strong curvature to the full-length ectodomain.By similarity

Sequence similaritiesi

Contains 5 cadherin domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal

Phylogenomic databases

GeneTreeiENSGT00760000118906.
HOGENOMiHOG000169079.
HOVERGENiHBG106438.
InParanoidiP55290.
KOiK06808.
OMAiTIATYQL.
OrthoDBiEOG091G02OG.
PhylomeDBiP55290.

Family and domain databases

Gene3Di2.60.40.60. 6 hits.
InterProiIPR002126. Cadherin.
IPR015919. Cadherin-like.
IPR020894. Cadherin_CS.
IPR014868. Cadherin_pro_dom.
IPR033216. CDH13.
[Graphical view]
PANTHERiPTHR24027:SF80. PTHR24027:SF80. 1 hit.
PfamiPF00028. Cadherin. 5 hits.
PF08758. Cadherin_pro. 1 hit.
[Graphical view]
PRINTSiPR00205. CADHERIN.
SMARTiSM00112. CA. 5 hits.
SM01055. Cadherin_pro. 1 hit.
[Graphical view]
SUPFAMiSSF49313. SSF49313. 6 hits.
PROSITEiPS00232. CADHERIN_1. 3 hits.
PS50268. CADHERIN_2. 5 hits.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P55290-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQPRTPLVLC VLLSQVLLLT SAEDLDCTPG FQQKVFHINQ PAEFIEDQSI
60 70 80 90 100
LNLTFSDCKG NDKLRYEVSS PYFKVNSDGG LVALRNITAV GKTLFVHART
110 120 130 140 150
PHAEDMAELV IVGGKDIQGS LQDIFKFART SPVPRQKRSI VVSPILIPEN
160 170 180 190 200
QRQPFPRDVG KVVDSDRPER SKFRLTGKGV DQEPKGIFRI NENTGSVSVT
210 220 230 240 250
RTLDREVIAV YQLFVETTDV NGKTLEGPVP LEVIVIDQND NRPIFREGPY
260 270 280 290 300
IGHVMEGSPT GTTVMRMTAF DADDPATDNA LLRYNIRQQT PDKPSPNMFY
310 320 330 340 350
IDPEKGDIVT VVSPALLDRE TLENPKYELI IEAQDMAGLD VGLTGTATAT
360 370 380 390 400
IMIDDKNDHS PKFTKKEFQA TVEEGAVGVI VNLTVEDKDD PTTGAWRAAY
410 420 430 440 450
TIINGNPGQS FEIHTNPQTN EGMLSVVKPL DYEISAFHTL LIKVENEDPL
460 470 480 490 500
VPDVSYGPSS TATVHITVLD VNEGPVFYPD PMMVTRQEDL SVGSVLLTVN
510 520 530 540 550
ATDPDSLQHQ TIRYSVYKDP AGWLNINPIN GTVDTTAVLD RESPFVDNSV
560 570 580 590 600
YTALFLAIDS GNPPATGTGT LLITLEDVND NAPFIYPTVA EVCDDAKNLS
610 620 630 640 650
VVILGASDKD LHPNTDPFKF EIHKQAVPDK VWKISKINNT HALVSLLQNL
660 670 680 690 700
NKANYNLPIM VTDSGKPPMT NITDLRVQVC SCRNSKVDCN AAGALRFSLP
710
SVLLLSLFSL ACL
Length:713
Mass (Da):78,287
Last modified:October 1, 1996 - v1
Checksum:iCEB662D77824CB60
GO
Isoform 2 (identifier: P55290-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     162-190: VVDSDRPERSKFRLTGKGVDQEPKGIFRI → RTHNPINSELLLNEGITADLNPCITILAI
     191-713: Missing.

Show »
Length:190
Mass (Da):21,058
Checksum:iC7DA89A2C0C036E9
GO
Isoform 3 (identifier: P55290-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     162-175: VVDSDRPERSKFRL → MKIWQVLCLARWLT
     176-713: Missing.

Show »
Length:175
Mass (Da):19,660
Checksum:i0038FABE744ECAE0
GO
Isoform 4 (identifier: P55290-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: MQPRTPLVLCVLLS → MKTPPGASSRTKCSRELRSFCAFSCPRAKQPTCTAWFPQQEHPSENGPQMPGRDPPAASTM

Note: Gene prediction based on EST data.
Show »
Length:760
Mass (Da):83,397
Checksum:iB4BB30012F3D4560
GO
Isoform 5 (identifier: P55290-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     123-161: Missing.

Note: No experimental confirmation available.
Show »
Length:674
Mass (Da):73,787
Checksum:i4C15F7C62AE5B0AA
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti199V → M in AAH28624 (Ref. 4) Curated1
Sequence conflicti199V → M in AAH30653 (Ref. 4) Curated1
Sequence conflicti288Q → R in AAH28624 (Ref. 4) Curated1
Sequence conflicti288Q → R in AAH30653 (Ref. 4) Curated1
Sequence conflicti392T → A in AAH28624 (Ref. 4) Curated1
Sequence conflicti392T → A in AAH30653 (Ref. 4) Curated1
Sequence conflicti544P → T in AAH28624 (Ref. 4) Curated1
Sequence conflicti544P → T in AAH30653 (Ref. 4) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06574765R → C in a patient with amyotrophic lateral sclerosis. 1 PublicationCorresponds to variant rs368685803dbSNPEnsembl.1
Natural variantiVAR_065748103A → V in a patient with amyotrophic lateral sclerosis. 1 PublicationCorresponds to variant rs199539898dbSNPEnsembl.1
Natural variantiVAR_065749113G → R in a patient with amyotrophic lateral sclerosis. 1 PublicationCorresponds to variant rs183971768dbSNPEnsembl.1
Natural variantiVAR_030632121L → S.Corresponds to variant rs7197352dbSNPEnsembl.1
Natural variantiVAR_065750246R → W in a patient with amyotrophic lateral sclerosis. 1 PublicationCorresponds to variant rs377210458dbSNPEnsembl.1
Natural variantiVAR_065751367E → Q in a patient with amyotrophic lateral sclerosis. 1 PublicationCorresponds to variant rs200000145dbSNPEnsembl.1
Natural variantiVAR_065752376A → T.1 PublicationCorresponds to variant rs35549391dbSNPEnsembl.1
Natural variantiVAR_065753643L → R.1 PublicationCorresponds to variant rs34106627dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0467141 – 14MQPRT…CVLLS → MKTPPGASSRTKCSRELRSF CAFSCPRAKQPTCTAWFPQQ EHPSENGPQMPGRDPPAAST M in isoform 4. CuratedAdd BLAST14
Alternative sequenceiVSP_053739123 – 161Missing in isoform 5. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_042696162 – 190VVDSD…GIFRI → RTHNPINSELLLNEGITADL NPCITILAI in isoform 2. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_042794162 – 175VVDSD…SKFRL → MKIWQVLCLARWLT in isoform 3. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_042795176 – 713Missing in isoform 3. 1 PublicationAdd BLAST538
Alternative sequenceiVSP_042697191 – 713Missing in isoform 2. 1 PublicationAdd BLAST523

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L34058 mRNA. Translation: AAA35624.1.
U59289 mRNA. Translation: AAB18912.1.
U59288 mRNA. Translation: AAB18911.1.
AB001103 Genomic DNA. Translation: BAA32411.1.
EU190357 mRNA. Translation: ABW97440.1.
EU190358 mRNA. Translation: ABW97441.1.
AK298612 mRNA. Translation: BAH12826.1.
AC009028 Genomic DNA. No translation available.
AC009063 Genomic DNA. No translation available.
AC009119 Genomic DNA. No translation available.
AC009142 Genomic DNA. No translation available.
AC087189 Genomic DNA. No translation available.
AC092340 Genomic DNA. No translation available.
AC092351 Genomic DNA. No translation available.
AC098804 Genomic DNA. No translation available.
AC099506 Genomic DNA. No translation available.
AC106814 Genomic DNA. No translation available.
AC125793 Genomic DNA. No translation available.
BC028624 mRNA. Translation: AAH28624.1.
BC030653 mRNA. Translation: AAH30653.1.
CCDSiCCDS56009.1. [P55290-3]
CCDS56010.1. [P55290-2]
CCDS58485.1. [P55290-4]
CCDS58486.1. [P55290-1]
CCDS58487.1. [P55290-5]
PIRiB38992.
RefSeqiNP_001207418.1. NM_001220489.1. [P55290-5]
NP_001207420.1. NM_001220491.1. [P55290-2]
NP_001207421.1. NM_001220492.1. [P55290-3]
NP_001248.1. NM_001257.4. [P55290-1]
UniGeneiHs.654386.
Hs.661776.

Genome annotation databases

EnsembliENST00000268613; ENSP00000268613; ENSG00000140945. [P55290-4]
ENST00000428848; ENSP00000394557; ENSG00000140945. [P55290-5]
ENST00000431540; ENSP00000408632; ENSG00000140945. [P55290-2]
ENST00000565636; ENSP00000456491; ENSG00000140945. [P55290-3]
ENST00000567109; ENSP00000479395; ENSG00000140945. [P55290-1]
GeneIDi1012.
KEGGihsa:1012.
UCSCiuc002fgx.4. human. [P55290-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L34058 mRNA. Translation: AAA35624.1.
U59289 mRNA. Translation: AAB18912.1.
U59288 mRNA. Translation: AAB18911.1.
AB001103 Genomic DNA. Translation: BAA32411.1.
EU190357 mRNA. Translation: ABW97440.1.
EU190358 mRNA. Translation: ABW97441.1.
AK298612 mRNA. Translation: BAH12826.1.
AC009028 Genomic DNA. No translation available.
AC009063 Genomic DNA. No translation available.
AC009119 Genomic DNA. No translation available.
AC009142 Genomic DNA. No translation available.
AC087189 Genomic DNA. No translation available.
AC092340 Genomic DNA. No translation available.
AC092351 Genomic DNA. No translation available.
AC098804 Genomic DNA. No translation available.
AC099506 Genomic DNA. No translation available.
AC106814 Genomic DNA. No translation available.
AC125793 Genomic DNA. No translation available.
BC028624 mRNA. Translation: AAH28624.1.
BC030653 mRNA. Translation: AAH30653.1.
CCDSiCCDS56009.1. [P55290-3]
CCDS56010.1. [P55290-2]
CCDS58485.1. [P55290-4]
CCDS58486.1. [P55290-1]
CCDS58487.1. [P55290-5]
PIRiB38992.
RefSeqiNP_001207418.1. NM_001220489.1. [P55290-5]
NP_001207420.1. NM_001220491.1. [P55290-2]
NP_001207421.1. NM_001220492.1. [P55290-3]
NP_001248.1. NM_001257.4. [P55290-1]
UniGeneiHs.654386.
Hs.661776.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2V37NMR-A139-243[»]
ProteinModelPortaliP55290.
SMRiP55290.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107447. 28 interactors.
IntActiP55290. 9 interactors.
MINTiMINT-7004770.

PTM databases

iPTMnetiP55290.
PhosphoSitePlusiP55290.
SwissPalmiP55290.

Polymorphism and mutation databases

BioMutaiCDH13.
DMDMi1705552.

Proteomic databases

EPDiP55290.
MaxQBiP55290.
PeptideAtlasiP55290.
PRIDEiP55290.
TopDownProteomicsiP55290-1. [P55290-1]

Protocols and materials databases

DNASUi1012.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000268613; ENSP00000268613; ENSG00000140945. [P55290-4]
ENST00000428848; ENSP00000394557; ENSG00000140945. [P55290-5]
ENST00000431540; ENSP00000408632; ENSG00000140945. [P55290-2]
ENST00000565636; ENSP00000456491; ENSG00000140945. [P55290-3]
ENST00000567109; ENSP00000479395; ENSG00000140945. [P55290-1]
GeneIDi1012.
KEGGihsa:1012.
UCSCiuc002fgx.4. human. [P55290-1]

Organism-specific databases

CTDi1012.
DisGeNETi1012.
GeneCardsiCDH13.
HGNCiHGNC:1753. CDH13.
HPAiCAB025863.
HPA001380.
MIMi601364. gene.
neXtProtiNX_P55290.
OpenTargetsiENSG00000140945.
PharmGKBiPA26287.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00760000118906.
HOGENOMiHOG000169079.
HOVERGENiHBG106438.
InParanoidiP55290.
KOiK06808.
OMAiTIATYQL.
OrthoDBiEOG091G02OG.
PhylomeDBiP55290.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000140945-MONOMER.
ReactomeiR-HSA-418990. Adherens junctions interactions.
SIGNORiP55290.

Miscellaneous databases

ChiTaRSiCDH13. human.
EvolutionaryTraceiP55290.
GeneWikiiT-cadherin.
GenomeRNAii1012.
PROiP55290.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000140945.
CleanExiHS_CDH13.
ExpressionAtlasiP55290. baseline and differential.

Family and domain databases

Gene3Di2.60.40.60. 6 hits.
InterProiIPR002126. Cadherin.
IPR015919. Cadherin-like.
IPR020894. Cadherin_CS.
IPR014868. Cadherin_pro_dom.
IPR033216. CDH13.
[Graphical view]
PANTHERiPTHR24027:SF80. PTHR24027:SF80. 1 hit.
PfamiPF00028. Cadherin. 5 hits.
PF08758. Cadherin_pro. 1 hit.
[Graphical view]
PRINTSiPR00205. CADHERIN.
SMARTiSM00112. CA. 5 hits.
SM01055. Cadherin_pro. 1 hit.
[Graphical view]
SUPFAMiSSF49313. SSF49313. 6 hits.
PROSITEiPS00232. CADHERIN_1. 3 hits.
PS50268. CADHERIN_2. 5 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCAD13_HUMAN
AccessioniPrimary (citable) accession number: P55290
Secondary accession number(s): A8W476
, A8W477, B7Z590, C9JRI6, J3KN62, Q6GTW4, Q8TBX3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: October 1, 1996
Last modified: November 2, 2016
This is version 161 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.