Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P55285

- CADH6_HUMAN

UniProt

P55285 - CADH6_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Cadherin-6

Gene

CDH6

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types.

GO - Molecular functioni

  1. calcium ion binding Source: InterPro

GO - Biological processi

  1. adherens junction organization Source: Reactome
  2. cell adhesion Source: ProtInc
  3. cell-cell junction organization Source: Reactome
  4. cell junction assembly Source: Reactome
  5. homophilic cell adhesion Source: InterPro
Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Keywords - Ligandi

Calcium, Metal-binding

Enzyme and pathway databases

ReactomeiREACT_19195. Adherens junctions interactions.

Names & Taxonomyi

Protein namesi
Recommended name:
Cadherin-6
Alternative name(s):
Kidney cadherin
Short name:
K-cadherin
Gene namesi
Name:CDH6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 5

Organism-specific databases

HGNCiHGNC:1765. CDH6.

Subcellular locationi

GO - Cellular componenti

  1. extracellular vesicular exosome Source: UniProt
  2. integral component of membrane Source: UniProtKB-KW
  3. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA26302.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1818Sequence AnalysisAdd
BLAST
Propeptidei19 – 5335Sequence AnalysisPRO_0000003761Add
BLAST
Chaini54 – 790737Cadherin-6PRO_0000003762Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi49 – 491N-linked (GlcNAc...)Sequence Analysis
Glycosylationi255 – 2551N-linked (GlcNAc...)Sequence Analysis
Glycosylationi399 – 3991N-linked (GlcNAc...)1 Publication
Glycosylationi437 – 4371N-linked (GlcNAc...)Sequence Analysis
Glycosylationi455 – 4551N-linked (GlcNAc...)Sequence Analysis
Glycosylationi536 – 5361N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Cleavage on pair of basic residues, Glycoprotein

Proteomic databases

PaxDbiP55285.
PRIDEiP55285.

PTM databases

PhosphoSiteiP55285.

Expressioni

Tissue specificityi

Highly expressed in brain, cerebellum, and kidney. Lung, pancreas, and gastric mucosa show a weak expression. Also expressed in certain liver and kidney carcinomas.

Gene expression databases

BgeeiP55285.
CleanExiHS_CDH6.
ExpressionAtlasiP55285. baseline and differential.
GenevestigatoriP55285.

Organism-specific databases

HPAiCAB025274.
HPA007047.
HPA007456.

Interactioni

Protein-protein interaction databases

BioGridi107439. 3 interactions.
STRINGi9606.ENSP00000265071.

Structurei

3D structure databases

ProteinModelPortaliP55285.
SMRiP55285. Positions 54-589, 689-783.
ModBaseiSearch...
MobiDBiSearch...

Topological domain

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini54 – 615562ExtracellularSequence AnalysisAdd
BLAST
Topological domaini637 – 790154CytoplasmicSequence AnalysisAdd
BLAST

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei616 – 63621HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini54 – 159106Cadherin 1PROSITE-ProRule annotationAdd
BLAST
Domaini160 – 268109Cadherin 2PROSITE-ProRule annotationAdd
BLAST
Domaini269 – 383115Cadherin 3PROSITE-ProRule annotationAdd
BLAST
Domaini384 – 486103Cadherin 4PROSITE-ProRule annotationAdd
BLAST
Domaini487 – 608122Cadherin 5PROSITE-ProRule annotationAdd
BLAST

Domaini

Three calcium ions are usually bound at the interface of each cadherin domain and rigidify the connections, imparting a strong curvature to the full-length ectodomain.By similarity

Sequence similaritiesi

Contains 5 cadherin domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG257411.
GeneTreeiENSGT00760000118954.
HOGENOMiHOG000231252.
HOVERGENiHBG005217.
InParanoidiP55285.
KOiK06798.
OMAiRHEMSTY.
PhylomeDBiP55285.
TreeFamiTF329887.

Family and domain databases

Gene3Di2.60.40.60. 5 hits.
4.10.900.10. 1 hit.
InterProiIPR002126. Cadherin.
IPR015919. Cadherin-like.
IPR020894. Cadherin_CS.
IPR000233. Cadherin_cytoplasmic-dom.
IPR027397. Catenin_binding_dom.
[Graphical view]
PfamiPF00028. Cadherin. 5 hits.
PF01049. Cadherin_C. 1 hit.
[Graphical view]
PRINTSiPR00205. CADHERIN.
SMARTiSM00112. CA. 5 hits.
[Graphical view]
SUPFAMiSSF49313. SSF49313. 5 hits.
PROSITEiPS00232. CADHERIN_1. 3 hits.
PS50268. CADHERIN_2. 5 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P55285-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRTYRYFLLL FWVGQPYPTL STPLSKRTSG FPAKKRALEL SGNSKNELNR
60 70 80 90 100
SKRSWMWNQF FLLEEYTGSD YQYVGKLHSD QDRGDGSLKY ILSGDGAGDL
110 120 130 140 150
FIINENTGDI QATKRLDREE KPVYILRAQA INRRTGRPVE PESEFIIKIH
160 170 180 190 200
DINDNEPIFT KEVYTATVPE MSDVGTFVVQ VTATDADDPT YGNSAKVVYS
210 220 230 240 250
ILQGQPYFSV ESETGIIKTA LLNMDRENRE QYQVVIQAKD MGGQMGGLSG
260 270 280 290 300
TTTVNITLTD VNDNPPRFPQ STYQFKTPES SPPGTPIGRI KASDADVGEN
310 320 330 340 350
AEIEYSITDG EGLDMFDVIT DQETQEGIIT VKKLLDFEKK KVYTLKVEAS
360 370 380 390 400
NPYVEPRFLY LGPFKDSATV RIVVEDVDEP PVFSKLAYIL QIREDAQINT
410 420 430 440 450
TIGSVTAQDP DAARNPVKYS VDRHTDMDRI FNIDSGNGSI FTSKLLDRET
460 470 480 490 500
LLWHNITVIA TEINNPKQSS RVPLYIKVLD VNDNAPEFAE FYETFVCEKA
510 520 530 540 550
KADQLIQTLH AVDKDDPYSG HQFSFSLAPE AASGSNFTIQ DNKDNTAGIL
560 570 580 590 600
TRKNGYNRHE MSTYLLPVVI SDNDYPVQSS TGTVTVRVCA CDHHGNMQSC
610 620 630 640 650
HAEALIHPTG LSTGALVAIL LCIVILLVTV VLFAALRRQR KKEPLIISKE
660 670 680 690 700
DIRDNIVSYN DEGGGEEDTQ AFDIGTLRNP EAIEDNKLRR DIVPEALFLP
710 720 730 740 750
RRTPTARDNT DVRDFINQRL KENDTDPTAP PYDSLATYAY EGTGSVADSL
760 770 780 790
SSLESVTTDA DQDYDYLSDW GPRFKKLADM YGGVDSDKDS
Length:790
Mass (Da):88,309
Last modified:October 1, 1996 - v1
Checksum:iC175004FC8A61100
GO
Isoform 2 (identifier: P55285-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     628-663: VTVVLFAALRRQRKKEPLIISKEDIRDNIVSYNDEG → GKLVLPASYLPMVRGSHCYCDTLDLSASPIKAYSLI
     664-790: Missing.

Show »
Length:663
Mass (Da):73,864
Checksum:i97319C50BED1DC28
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti421 – 4211V → I no nucleotide entry (PubMed:2059658)Curated
Sequence conflicti425 – 4251T → I no nucleotide entry (PubMed:2059658)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei628 – 66336VTVVL…YNDEG → GKLVLPASYLPMVRGSHCYC DTLDLSASPIKAYSLI in isoform 2. 1 PublicationVSP_000636Add
BLAST
Alternative sequencei664 – 790127Missing in isoform 2. 1 PublicationVSP_000637Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
D31784 mRNA. Translation: BAA06562.1.
AK291290 mRNA. Translation: BAF83979.1.
CH471118 Genomic DNA. Translation: EAX10764.1.
BC000019 mRNA. Translation: AAH00019.1.
CCDSiCCDS3894.1. [P55285-1]
PIRiI37016.
RefSeqiNP_004923.1. NM_004932.3. [P55285-1]
UniGeneiHs.124776.
Hs.171054.

Genome annotation databases

EnsembliENST00000265071; ENSP00000265071; ENSG00000113361. [P55285-1]
GeneIDi1004.
KEGGihsa:1004.
UCSCiuc003jhd.2. human. [P55285-2]
uc003jhe.2. human. [P55285-1]

Polymorphism databases

DMDMi1705545.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
D31784 mRNA. Translation: BAA06562.1 .
AK291290 mRNA. Translation: BAF83979.1 .
CH471118 Genomic DNA. Translation: EAX10764.1 .
BC000019 mRNA. Translation: AAH00019.1 .
CCDSi CCDS3894.1. [P55285-1 ]
PIRi I37016.
RefSeqi NP_004923.1. NM_004932.3. [P55285-1 ]
UniGenei Hs.124776.
Hs.171054.

3D structure databases

ProteinModelPortali P55285.
SMRi P55285. Positions 54-589, 689-783.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 107439. 3 interactions.
STRINGi 9606.ENSP00000265071.

PTM databases

PhosphoSitei P55285.

Polymorphism databases

DMDMi 1705545.

Proteomic databases

PaxDbi P55285.
PRIDEi P55285.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000265071 ; ENSP00000265071 ; ENSG00000113361 . [P55285-1 ]
GeneIDi 1004.
KEGGi hsa:1004.
UCSCi uc003jhd.2. human. [P55285-2 ]
uc003jhe.2. human. [P55285-1 ]

Organism-specific databases

CTDi 1004.
GeneCardsi GC05P031229.
HGNCi HGNC:1765. CDH6.
HPAi CAB025274.
HPA007047.
HPA007456.
MIMi 603007. gene.
neXtProti NX_P55285.
PharmGKBi PA26302.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG257411.
GeneTreei ENSGT00760000118954.
HOGENOMi HOG000231252.
HOVERGENi HBG005217.
InParanoidi P55285.
KOi K06798.
OMAi RHEMSTY.
PhylomeDBi P55285.
TreeFami TF329887.

Enzyme and pathway databases

Reactomei REACT_19195. Adherens junctions interactions.

Miscellaneous databases

GeneWikii CDH6.
GenomeRNAii 1004.
NextBioi 4220.
PROi P55285.
SOURCEi Search...

Gene expression databases

Bgeei P55285.
CleanExi HS_CDH6.
ExpressionAtlasi P55285. baseline and differential.
Genevestigatori P55285.

Family and domain databases

Gene3Di 2.60.40.60. 5 hits.
4.10.900.10. 1 hit.
InterProi IPR002126. Cadherin.
IPR015919. Cadherin-like.
IPR020894. Cadherin_CS.
IPR000233. Cadherin_cytoplasmic-dom.
IPR027397. Catenin_binding_dom.
[Graphical view ]
Pfami PF00028. Cadherin. 5 hits.
PF01049. Cadherin_C. 1 hit.
[Graphical view ]
PRINTSi PR00205. CADHERIN.
SMARTi SM00112. CA. 5 hits.
[Graphical view ]
SUPFAMi SSF49313. SSF49313. 5 hits.
PROSITEi PS00232. CADHERIN_1. 3 hits.
PS50268. CADHERIN_2. 5 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Isolation and sequence analysis of human cadherin-6 complementary DNA for the full coding sequence and its expression in human carcinoma cells."
    Shimoyama Y., Gotoh M., Terasaki T., Kitajima M., Hirohashi S.
    Cancer Res. 55:2206-2211(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Kidney.
  5. "Diversity of the cadherin family: evidence for eight new cadherins in nervous tissue."
    Suzuki S., Sano K., Tanihara H.
    Cell Regul. 2:261-270(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 377-790 (ISOFORM 1).
    Tissue: Fetal brain.
  6. "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry."
    Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D.
    J. Proteome Res. 4:2070-2080(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-399.
    Tissue: Plasma.
  7. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiCADH6_HUMAN
AccessioniPrimary (citable) accession number: P55285
Secondary accession number(s): A8K5H5, Q9BWS0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: October 1, 1996
Last modified: October 29, 2014
This is version 130 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3