Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cadherin-6

Gene

CDH6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types.

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processCell adhesion
LigandCalcium, Metal-binding

Enzyme and pathway databases

ReactomeiR-HSA-418990. Adherens junctions interactions.

Names & Taxonomyi

Protein namesi
Recommended name:
Cadherin-6
Alternative name(s):
Kidney cadherin
Short name:
K-cadherin
Gene namesi
Name:CDH6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

EuPathDBiHostDB:ENSG00000113361.12.
HGNCiHGNC:1765. CDH6.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini54 – 615ExtracellularSequence analysisAdd BLAST562
Transmembranei616 – 636HelicalSequence analysisAdd BLAST21
Topological domaini637 – 790CytoplasmicSequence analysisAdd BLAST154

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi1004.
OpenTargetsiENSG00000113361.
PharmGKBiPA26302.

Polymorphism and mutation databases

BioMutaiCDH6.
DMDMi1705545.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 18Sequence analysisAdd BLAST18
PropeptideiPRO_000000376119 – 53Sequence analysisAdd BLAST35
ChainiPRO_000000376254 – 790Cadherin-6Add BLAST737

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi49N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi255N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi399N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi437N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi455N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi536N-linked (GlcNAc...) asparagineSequence analysis1
Modified residuei786PhosphoserineBy similarity1
Modified residuei790PhosphoserineBy similarity1

Keywords - PTMi

Cleavage on pair of basic residues, Glycoprotein, Phosphoprotein

Proteomic databases

EPDiP55285.
PaxDbiP55285.
PeptideAtlasiP55285.
PRIDEiP55285.

PTM databases

iPTMnetiP55285.
PhosphoSitePlusiP55285.

Expressioni

Tissue specificityi

Highly expressed in brain, cerebellum, and kidney. Lung, pancreas, and gastric mucosa show a weak expression. Also expressed in certain liver and kidney carcinomas.

Gene expression databases

BgeeiENSG00000113361.
CleanExiHS_CDH6.
ExpressionAtlasiP55285. baseline and differential.
GenevisibleiP55285. HS.

Organism-specific databases

HPAiCAB025274.
HPA007047.
HPA007456.

Interactioni

Protein-protein interaction databases

BioGridi107439. 4 interactors.
STRINGi9606.ENSP00000265071.

Structurei

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5VEBX-ray2.34X/Y490-608[»]
ProteinModelPortaliP55285.
SMRiP55285.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini54 – 159Cadherin 1PROSITE-ProRule annotationAdd BLAST106
Domaini160 – 268Cadherin 2PROSITE-ProRule annotationAdd BLAST109
Domaini269 – 383Cadherin 3PROSITE-ProRule annotationAdd BLAST115
Domaini384 – 486Cadherin 4PROSITE-ProRule annotationAdd BLAST103
Domaini487 – 608Cadherin 5PROSITE-ProRule annotationAdd BLAST122

Domaini

Three calcium ions are usually bound at the interface of each cadherin domain and rigidify the connections, imparting a strong curvature to the full-length ectodomain.By similarity

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3594. Eukaryota.
ENOG410XQHI. LUCA.
GeneTreeiENSGT00760000118954.
HOGENOMiHOG000231252.
HOVERGENiHBG005217.
InParanoidiP55285.
KOiK06798.
OMAiSWMWNQF.
OrthoDBiEOG091G0298.
PhylomeDBiP55285.
TreeFamiTF329887.

Family and domain databases

Gene3Di4.10.900.10. 1 hit.
InterProiView protein in InterPro
IPR002126. Cadherin.
IPR015919. Cadherin-like.
IPR020894. Cadherin_CS.
IPR000233. Cadherin_cytoplasmic-dom.
IPR027397. Catenin_binding_dom.
PfamiView protein in Pfam
PF00028. Cadherin. 5 hits.
PF01049. Cadherin_C. 1 hit.
PRINTSiPR00205. CADHERIN.
SMARTiView protein in SMART
SM00112. CA. 5 hits.
SUPFAMiSSF49313. SSF49313. 5 hits.
PROSITEiView protein in PROSITE
PS00232. CADHERIN_1. 3 hits.
PS50268. CADHERIN_2. 5 hits.

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P55285-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRTYRYFLLL FWVGQPYPTL STPLSKRTSG FPAKKRALEL SGNSKNELNR
60 70 80 90 100
SKRSWMWNQF FLLEEYTGSD YQYVGKLHSD QDRGDGSLKY ILSGDGAGDL
110 120 130 140 150
FIINENTGDI QATKRLDREE KPVYILRAQA INRRTGRPVE PESEFIIKIH
160 170 180 190 200
DINDNEPIFT KEVYTATVPE MSDVGTFVVQ VTATDADDPT YGNSAKVVYS
210 220 230 240 250
ILQGQPYFSV ESETGIIKTA LLNMDRENRE QYQVVIQAKD MGGQMGGLSG
260 270 280 290 300
TTTVNITLTD VNDNPPRFPQ STYQFKTPES SPPGTPIGRI KASDADVGEN
310 320 330 340 350
AEIEYSITDG EGLDMFDVIT DQETQEGIIT VKKLLDFEKK KVYTLKVEAS
360 370 380 390 400
NPYVEPRFLY LGPFKDSATV RIVVEDVDEP PVFSKLAYIL QIREDAQINT
410 420 430 440 450
TIGSVTAQDP DAARNPVKYS VDRHTDMDRI FNIDSGNGSI FTSKLLDRET
460 470 480 490 500
LLWHNITVIA TEINNPKQSS RVPLYIKVLD VNDNAPEFAE FYETFVCEKA
510 520 530 540 550
KADQLIQTLH AVDKDDPYSG HQFSFSLAPE AASGSNFTIQ DNKDNTAGIL
560 570 580 590 600
TRKNGYNRHE MSTYLLPVVI SDNDYPVQSS TGTVTVRVCA CDHHGNMQSC
610 620 630 640 650
HAEALIHPTG LSTGALVAIL LCIVILLVTV VLFAALRRQR KKEPLIISKE
660 670 680 690 700
DIRDNIVSYN DEGGGEEDTQ AFDIGTLRNP EAIEDNKLRR DIVPEALFLP
710 720 730 740 750
RRTPTARDNT DVRDFINQRL KENDTDPTAP PYDSLATYAY EGTGSVADSL
760 770 780 790
SSLESVTTDA DQDYDYLSDW GPRFKKLADM YGGVDSDKDS
Length:790
Mass (Da):88,309
Last modified:October 1, 1996 - v1
Checksum:iC175004FC8A61100
GO
Isoform 2 (identifier: P55285-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     628-663: VTVVLFAALRRQRKKEPLIISKEDIRDNIVSYNDEG → GKLVLPASYLPMVRGSHCYCDTLDLSASPIKAYSLI
     664-790: Missing.

Show »
Length:663
Mass (Da):73,864
Checksum:i97319C50BED1DC28
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti421V → I no nucleotide entry (PubMed:2059658).Curated1
Sequence conflicti425T → I no nucleotide entry (PubMed:2059658).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_000636628 – 663VTVVL…YNDEG → GKLVLPASYLPMVRGSHCYC DTLDLSASPIKAYSLI in isoform 2. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_000637664 – 790Missing in isoform 2. 1 PublicationAdd BLAST127

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D31784 mRNA. Translation: BAA06562.1.
AK291290 mRNA. Translation: BAF83979.1.
CH471118 Genomic DNA. Translation: EAX10764.1.
BC000019 mRNA. Translation: AAH00019.1.
CCDSiCCDS3894.1. [P55285-1]
PIRiI37016.
RefSeqiNP_004923.1. NM_004932.3. [P55285-1]
XP_011512223.1. XM_011513921.2. [P55285-1]
XP_016864399.1. XM_017008910.1. [P55285-1]
XP_016864400.1. XM_017008911.1. [P55285-2]
UniGeneiHs.124776.
Hs.171054.

Genome annotation databases

EnsembliENST00000265071; ENSP00000265071; ENSG00000113361. [P55285-1]
GeneIDi1004.
KEGGihsa:1004.
UCSCiuc003jhe.3. human. [P55285-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiCADH6_HUMAN
AccessioniPrimary (citable) accession number: P55285
Secondary accession number(s): A8K5H5, Q9BWS0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: October 1, 1996
Last modified: September 27, 2017
This is version 155 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references