P55285 (CADH6_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 117.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Cadherin-6 Alternative name(s): Kidney cadherin Short name=K-cadherin | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 790 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. |
| Subcellular location | |
| Tissue specificity | Highly expressed in brain, cerebellum, and kidney. Lung, pancreas, and gastric mucosa show a weak expression. Also expressed in certain liver and kidney carcinomas. |
| Domain | Three calcium ions are usually bound at the interface of each cadherin domain and rigidify the connections, imparting a strong curvature to the full-length ectodomain By similarity. |
| Sequence similarities | Contains 5 cadherin domains. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Cell adhesion |
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat Signal Transmembrane Transmembrane helix |
| Ligand | Calcium Metal-binding |
| PTM | Cleavage on pair of basic residues Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | adherens junction organization Traceable author statement. Source: Reactome cell adhesionTraceable author statement Ref.1. Source: ProtInc cell junction assemblyTraceable author statement. Source: Reactome homophilic cell adhesionInferred from electronic annotation. Source: InterPro |
| Cellular_component | cytoplasm Inferred from direct assay. Source: HPA integral to membraneInferred from electronic annotation. Source: UniProtKB-KW nucleusInferred from direct assay. Source: HPA plasma membraneInferred from direct assay. Source: HPA |
| Molecular_function | calcium ion binding Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P55285-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P55285-2) The sequence of this isoform differs from the canonical sequence as follows: 628-663: VTVVLFAALRRQRKKEPLIISKEDIRDNIVSYNDEG → GKLVLPASYLPMVRGSHCYCDTLDLSASPIKAYSLI 664-790: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 18 | 18 | Potential | ||||||
| Propeptide | 19 – 53 | 35 | Potential | PRO_0000003761 | |||||
| Chain | 54 – 790 | 737 | Cadherin-6 | PRO_0000003762 | |||||
Regions | |||||||||
| Topological domain | 54 – 615 | 562 | Extracellular Potential | ||||||
| Transmembrane | 616 – 636 | 21 | Helical; Potential | ||||||
| Topological domain | 637 – 790 | 154 | Cytoplasmic Potential | ||||||
| Domain | 54 – 159 | 106 | Cadherin 1 | ||||||
| Domain | 160 – 268 | 109 | Cadherin 2 | ||||||
| Domain | 269 – 383 | 115 | Cadherin 3 | ||||||
| Domain | 384 – 486 | 103 | Cadherin 4 | ||||||
| Domain | 487 – 608 | 122 | Cadherin 5 | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 49 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 255 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 399 | 1 | N-linked (GlcNAc...) Ref.6 | ||||||
| Glycosylation | 437 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 455 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 536 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 628 – 663 | 36 | VTVVL…YNDEG → GKLVLPASYLPMVRGSHCYC DTLDLSASPIKAYSLI in isoform 2. | VSP_000636 | |||||
| Alternative sequence | 664 – 790 | 127 | Missing in isoform 2. | VSP_000637 | |||||
Experimental info | |||||||||
| Sequence conflict | 421 | 1 | V → I no nucleotide entry Ref.5 | ||||||
| Sequence conflict | 425 | 1 | T → I no nucleotide entry Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Isolation and sequence analysis of human cadherin-6 complementary DNA for the full coding sequence and its expression in human carcinoma cells." Shimoyama Y., Gotoh M., Terasaki T., Kitajima M., Hirohashi S. Cancer Res. 55:2206-2211(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [3] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Kidney. |
| [5] | "Diversity of the cadherin family: evidence for eight new cadherins in nervous tissue." Suzuki S., Sano K., Tanihara H. Cell Regul. 2:261-270(1991) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 377-790 (ISOFORM 1). Tissue: Fetal brain. |
| [6] | "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry." Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D. J. Proteome Res. 4:2070-2080(2005) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-399, MASS SPECTROMETRY. Tissue: Plasma. |
| [7] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | D31784 mRNA. Translation: BAA06562.1. AK291290 mRNA. Translation: BAF83979.1. CH471118 Genomic DNA. Translation: EAX10764.1. BC000019 mRNA. Translation: AAH00019.1. |
| IPI | IPI00024035. IPI00217314. |
| PIR | I37016. |
| RefSeq | NP_004923.1. NM_004932.3. |
| UniGene | Hs.124776. Hs.171054. |
3D structure databases | |
| ProteinModelPortal | P55285. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000265071. |
PTM databases | |
| PhosphoSite | P55285. |
Polymorphism databases | |
| DMDM | 1705545. |
Proteomic databases | |
| PaxDb | P55285. |
| PRIDE | P55285. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000265071; ENSP00000265071; ENSG00000113361. |
| GeneID | 1004. |
| KEGG | hsa:1004. |
| UCSC | uc003jhd.2. human. uc003jhe.2. human. |
Organism-specific databases | |
| CTD | 1004. |
| GeneCards | GC05P031229. |
| HGNC | HGNC:1765. CDH6. |
| HPA | CAB025274. HPA007047. HPA007456. |
| MIM | 603007. gene. |
| neXtProt | NX_P55285. |
| PharmGKB | PA26302. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG257411. |
| HOGENOM | HOG000231252. |
| HOVERGEN | HBG005217. |
| InParanoid | P55285. |
| KO | K06798. |
| OMA | RHEMSTY. |
| OrthoDB | EOG4CZBF8. |
| PhylomeDB | P55285. |
Enzyme and pathway databases | |
| Reactome | REACT_111155. Cell-Cell communication. |
Gene expression databases | |
| ArrayExpress | P55285. |
| Bgee | P55285. |
| CleanEx | HS_CDH6. |
| Genevestigator | P55285. |
| GermOnline | ENSG00000113361. Homo sapiens. |
Family and domain databases | |
| Gene3D | 2.60.40.60. 5 hits. |
| InterPro | IPR002126. Cadherin. IPR015919. Cadherin-like. IPR020894. Cadherin_CS. IPR000233. Cadherin_cytoplasmic-dom. [Graphical view] |
| Pfam | PF00028. Cadherin. 5 hits. PF01049. Cadherin_C. 1 hit. [Graphical view] |
| PRINTS | PR00205. CADHERIN. |
| SMART | SM00112. CA. 5 hits. [Graphical view] |
| SUPFAM | SSF49313. Cadherin. 5 hits. |
| PROSITE | PS00232. CADHERIN_1. 3 hits. PS50268. CADHERIN_2. 5 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 1004. |
| NextBio | 4220. |
| SOURCE | Search... |
Entry information
| Entry name | CADH6_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P55285 Secondary accession number(s): A8K5H5, Q9BWS0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 5 Human chromosome 5: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
