SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P55285

- CADH6_HUMAN

UniProt

P55285 - CADH6_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Cadherin-6
Gene
CDH6
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types.

GO - Molecular functioni

  1. calcium ion binding Source: InterPro

GO - Biological processi

  1. adherens junction organization Source: Reactome
  2. cell adhesion Source: ProtInc
  3. cell junction assembly Source: Reactome
  4. cell-cell junction organization Source: Reactome
  5. homophilic cell adhesion Source: InterPro
Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Keywords - Ligandi

Calcium, Metal-binding

Enzyme and pathway databases

ReactomeiREACT_19195. Adherens junctions interactions.

Names & Taxonomyi

Protein namesi
Recommended name:
Cadherin-6
Alternative name(s):
Kidney cadherin
Short name:
K-cadherin
Gene namesi
Name:CDH6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 5

Organism-specific databases

HGNCiHGNC:1765. CDH6.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini54 – 615562Extracellular Reviewed prediction
Add
BLAST
Transmembranei616 – 63621Helical; Reviewed prediction
Add
BLAST
Topological domaini637 – 790154Cytoplasmic Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. extracellular vesicular exosome Source: UniProt
  2. integral component of membrane Source: UniProtKB-KW
  3. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA26302.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1818 Reviewed prediction
Add
BLAST
Propeptidei19 – 5335 Reviewed prediction
PRO_0000003761Add
BLAST
Chaini54 – 790737Cadherin-6
PRO_0000003762Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi49 – 491N-linked (GlcNAc...) Reviewed prediction
Glycosylationi255 – 2551N-linked (GlcNAc...) Reviewed prediction
Glycosylationi399 – 3991N-linked (GlcNAc...)1 Publication
Glycosylationi437 – 4371N-linked (GlcNAc...) Reviewed prediction
Glycosylationi455 – 4551N-linked (GlcNAc...) Reviewed prediction
Glycosylationi536 – 5361N-linked (GlcNAc...) Reviewed prediction

Keywords - PTMi

Cleavage on pair of basic residues, Glycoprotein

Proteomic databases

PaxDbiP55285.
PRIDEiP55285.

PTM databases

PhosphoSiteiP55285.

Expressioni

Tissue specificityi

Highly expressed in brain, cerebellum, and kidney. Lung, pancreas, and gastric mucosa show a weak expression. Also expressed in certain liver and kidney carcinomas.

Gene expression databases

ArrayExpressiP55285.
BgeeiP55285.
CleanExiHS_CDH6.
GenevestigatoriP55285.

Organism-specific databases

HPAiCAB025274.
HPA007047.
HPA007456.

Interactioni

Protein-protein interaction databases

BioGridi107439. 3 interactions.
STRINGi9606.ENSP00000265071.

Structurei

3D structure databases

ProteinModelPortaliP55285.
SMRiP55285. Positions 54-589, 689-783.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini54 – 159106Cadherin 1
Add
BLAST
Domaini160 – 268109Cadherin 2
Add
BLAST
Domaini269 – 383115Cadherin 3
Add
BLAST
Domaini384 – 486103Cadherin 4
Add
BLAST
Domaini487 – 608122Cadherin 5
Add
BLAST

Domaini

Three calcium ions are usually bound at the interface of each cadherin domain and rigidify the connections, imparting a strong curvature to the full-length ectodomain By similarity.

Sequence similaritiesi

Contains 5 cadherin domains.

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG257411.
HOGENOMiHOG000231252.
HOVERGENiHBG005217.
InParanoidiP55285.
KOiK06798.
OMAiRHEMSTY.
PhylomeDBiP55285.
TreeFamiTF329887.

Family and domain databases

Gene3Di2.60.40.60. 5 hits.
4.10.900.10. 1 hit.
InterProiIPR002126. Cadherin.
IPR015919. Cadherin-like.
IPR020894. Cadherin_CS.
IPR000233. Cadherin_cytoplasmic-dom.
IPR027397. Catenin_binding_dom.
[Graphical view]
PfamiPF00028. Cadherin. 5 hits.
PF01049. Cadherin_C. 1 hit.
[Graphical view]
PRINTSiPR00205. CADHERIN.
SMARTiSM00112. CA. 5 hits.
[Graphical view]
SUPFAMiSSF49313. SSF49313. 5 hits.
PROSITEiPS00232. CADHERIN_1. 3 hits.
PS50268. CADHERIN_2. 5 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P55285-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MRTYRYFLLL FWVGQPYPTL STPLSKRTSG FPAKKRALEL SGNSKNELNR    50
SKRSWMWNQF FLLEEYTGSD YQYVGKLHSD QDRGDGSLKY ILSGDGAGDL 100
FIINENTGDI QATKRLDREE KPVYILRAQA INRRTGRPVE PESEFIIKIH 150
DINDNEPIFT KEVYTATVPE MSDVGTFVVQ VTATDADDPT YGNSAKVVYS 200
ILQGQPYFSV ESETGIIKTA LLNMDRENRE QYQVVIQAKD MGGQMGGLSG 250
TTTVNITLTD VNDNPPRFPQ STYQFKTPES SPPGTPIGRI KASDADVGEN 300
AEIEYSITDG EGLDMFDVIT DQETQEGIIT VKKLLDFEKK KVYTLKVEAS 350
NPYVEPRFLY LGPFKDSATV RIVVEDVDEP PVFSKLAYIL QIREDAQINT 400
TIGSVTAQDP DAARNPVKYS VDRHTDMDRI FNIDSGNGSI FTSKLLDRET 450
LLWHNITVIA TEINNPKQSS RVPLYIKVLD VNDNAPEFAE FYETFVCEKA 500
KADQLIQTLH AVDKDDPYSG HQFSFSLAPE AASGSNFTIQ DNKDNTAGIL 550
TRKNGYNRHE MSTYLLPVVI SDNDYPVQSS TGTVTVRVCA CDHHGNMQSC 600
HAEALIHPTG LSTGALVAIL LCIVILLVTV VLFAALRRQR KKEPLIISKE 650
DIRDNIVSYN DEGGGEEDTQ AFDIGTLRNP EAIEDNKLRR DIVPEALFLP 700
RRTPTARDNT DVRDFINQRL KENDTDPTAP PYDSLATYAY EGTGSVADSL 750
SSLESVTTDA DQDYDYLSDW GPRFKKLADM YGGVDSDKDS 790
Length:790
Mass (Da):88,309
Last modified:October 1, 1996 - v1
Checksum:iC175004FC8A61100
GO
Isoform 2 (identifier: P55285-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     628-663: VTVVLFAALRRQRKKEPLIISKEDIRDNIVSYNDEG → GKLVLPASYLPMVRGSHCYCDTLDLSASPIKAYSLI
     664-790: Missing.

Show »
Length:663
Mass (Da):73,864
Checksum:i97319C50BED1DC28
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei628 – 66336VTVVL…YNDEG → GKLVLPASYLPMVRGSHCYC DTLDLSASPIKAYSLI in isoform 2.
VSP_000636Add
BLAST
Alternative sequencei664 – 790127Missing in isoform 2.
VSP_000637Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti421 – 4211V → I no nucleotide entry 1 Publication
Sequence conflicti425 – 4251T → I no nucleotide entry 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
D31784 mRNA. Translation: BAA06562.1.
AK291290 mRNA. Translation: BAF83979.1.
CH471118 Genomic DNA. Translation: EAX10764.1.
BC000019 mRNA. Translation: AAH00019.1.
CCDSiCCDS3894.1. [P55285-1]
PIRiI37016.
RefSeqiNP_004923.1. NM_004932.3. [P55285-1]
UniGeneiHs.124776.
Hs.171054.

Genome annotation databases

EnsembliENST00000265071; ENSP00000265071; ENSG00000113361. [P55285-1]
GeneIDi1004.
KEGGihsa:1004.
UCSCiuc003jhd.2. human. [P55285-2]
uc003jhe.2. human. [P55285-1]

Polymorphism databases

DMDMi1705545.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
D31784 mRNA. Translation: BAA06562.1 .
AK291290 mRNA. Translation: BAF83979.1 .
CH471118 Genomic DNA. Translation: EAX10764.1 .
BC000019 mRNA. Translation: AAH00019.1 .
CCDSi CCDS3894.1. [P55285-1 ]
PIRi I37016.
RefSeqi NP_004923.1. NM_004932.3. [P55285-1 ]
UniGenei Hs.124776.
Hs.171054.

3D structure databases

ProteinModelPortali P55285.
SMRi P55285. Positions 54-589, 689-783.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 107439. 3 interactions.
STRINGi 9606.ENSP00000265071.

PTM databases

PhosphoSitei P55285.

Polymorphism databases

DMDMi 1705545.

Proteomic databases

PaxDbi P55285.
PRIDEi P55285.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000265071 ; ENSP00000265071 ; ENSG00000113361 . [P55285-1 ]
GeneIDi 1004.
KEGGi hsa:1004.
UCSCi uc003jhd.2. human. [P55285-2 ]
uc003jhe.2. human. [P55285-1 ]

Organism-specific databases

CTDi 1004.
GeneCardsi GC05P031229.
HGNCi HGNC:1765. CDH6.
HPAi CAB025274.
HPA007047.
HPA007456.
MIMi 603007. gene.
neXtProti NX_P55285.
PharmGKBi PA26302.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG257411.
HOGENOMi HOG000231252.
HOVERGENi HBG005217.
InParanoidi P55285.
KOi K06798.
OMAi RHEMSTY.
PhylomeDBi P55285.
TreeFami TF329887.

Enzyme and pathway databases

Reactomei REACT_19195. Adherens junctions interactions.

Miscellaneous databases

GeneWikii CDH6.
GenomeRNAii 1004.
NextBioi 4220.
PROi P55285.
SOURCEi Search...

Gene expression databases

ArrayExpressi P55285.
Bgeei P55285.
CleanExi HS_CDH6.
Genevestigatori P55285.

Family and domain databases

Gene3Di 2.60.40.60. 5 hits.
4.10.900.10. 1 hit.
InterProi IPR002126. Cadherin.
IPR015919. Cadherin-like.
IPR020894. Cadherin_CS.
IPR000233. Cadherin_cytoplasmic-dom.
IPR027397. Catenin_binding_dom.
[Graphical view ]
Pfami PF00028. Cadherin. 5 hits.
PF01049. Cadherin_C. 1 hit.
[Graphical view ]
PRINTSi PR00205. CADHERIN.
SMARTi SM00112. CA. 5 hits.
[Graphical view ]
SUPFAMi SSF49313. SSF49313. 5 hits.
PROSITEi PS00232. CADHERIN_1. 3 hits.
PS50268. CADHERIN_2. 5 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Isolation and sequence analysis of human cadherin-6 complementary DNA for the full coding sequence and its expression in human carcinoma cells."
    Shimoyama Y., Gotoh M., Terasaki T., Kitajima M., Hirohashi S.
    Cancer Res. 55:2206-2211(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Kidney.
  5. "Diversity of the cadherin family: evidence for eight new cadherins in nervous tissue."
    Suzuki S., Sano K., Tanihara H.
    Cell Regul. 2:261-270(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 377-790 (ISOFORM 1).
    Tissue: Fetal brain.
  6. "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry."
    Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D.
    J. Proteome Res. 4:2070-2080(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-399.
    Tissue: Plasma.
  7. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiCADH6_HUMAN
AccessioniPrimary (citable) accession number: P55285
Secondary accession number(s): A8K5H5, Q9BWS0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: October 1, 1996
Last modified: September 3, 2014
This is version 128 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi