Reviewed,
UniProtKB/Swiss-Prot P55285 (CADH6_HUMAN)
Last modified
June 16, 2009.
Version 77.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Cadherin-6 Alternative name(s): Kidney cadherin Short name=K-cadherin | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 790 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Cadherins are calcium dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. |
| Subcellular location | |
| Tissue specificity | Highly expressed in brain, cerebellum, and kidney. Lung, pancreas, and gastric mucosa show a weak expression. Also expressed in certain liver and kidney carcinomas. |
| Sequence similarities | Contains 5 cadherin domains. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Cell adhesion |
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat Signal Transmembrane |
| Ligand | Calcium |
| PTM | Cleavage on pair of basic residues Glycoprotein |
| Gene Ontology (GO) | |
| Biological process | homophilic cell adhesion Inferred from electronic annotation. Source: InterPro |
| Cellular component | cytoplasm Inferred from direct assay. Source: HPA integral to membraneInferred from electronic annotation. Source: UniProtKB-KW nucleusInferred from direct assay. Source: HPA plasma membraneInferred from direct assay. Source: HPA |
| Molecular function | calcium ion binding Inferred from electronic annotation. Source: UniProtKB-KW protein bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P55285-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P55285-2) The sequence of this isoform differs from the canonical sequence as follows: 628-663: VTVVLFAALRRQRKKEPLIISKEDIRDNIVSYNDEG → GKLVLPASYLPMVRGSHCYCDTLDLSASPIKAYSLI 664-790: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 18 | 18 | Potential | ||||||
| Propeptide | 19 – 53 | 35 | Potential | PRO_0000003761 | |||||
| Chain | 54 – 790 | 737 | Cadherin-6 | PRO_0000003762 | |||||
Regions | |||||||||
| Topological domain | 54 – 615 | 562 | Extracellular Potential | ||||||
| Transmembrane | 616 – 636 | 21 | Potential | ||||||
| Topological domain | 637 – 790 | 154 | Cytoplasmic Potential | ||||||
| Domain | 54 – 159 | 106 | Cadherin 1 | ||||||
| Domain | 160 – 268 | 109 | Cadherin 2 | ||||||
| Domain | 269 – 383 | 115 | Cadherin 3 | ||||||
| Domain | 384 – 486 | 103 | Cadherin 4 | ||||||
| Domain | 487 – 608 | 122 | Cadherin 5 | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 49 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 255 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 399 | 1 | N-linked (GlcNAc...) Ref.4 | ||||||
| Glycosylation | 437 | 1 | N-linked (GlcNAc...) Ref.5 | ||||||
| Glycosylation | 455 | 1 | N-linked (GlcNAc...) Ref.5 | ||||||
| Glycosylation | 536 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 628 – 663 | 36 | VTVVL…YNDEG → GKLVLPASYLPMVRGSHCYC DTLDLSASPIKAYSLI in isoform 2. | VSP_000636 | |||||
| Alternative sequence | 664 – 790 | 127 | Missing in isoform 2. | VSP_000637 | |||||
Experimental info | |||||||||
| Sequence conflict | 421 | 1 | V → I Ref.3 | ||||||
| Sequence conflict | 425 | 1 | T → I Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Isolation and sequence analysis of human cadherin-6 complementary DNA for the full coding sequence and its expression in human carcinoma cells." Shimoyama Y., Gotoh M., Terasaki T., Kitajima M., Hirohashi S. Cancer Res. 55:2206-2211(1995) [PubMed: 7743525] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Kidney. |
| [3] | "Diversity of the cadherin family: evidence for eight new cadherins in nervous tissue." Suzuki S., Sano K., Tanihara H. Cell Regul. 2:261-270(1991) [PubMed: 2059658] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 377-790 (ISOFORM 1). Tissue: Fetal brain. |
| [4] | "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry." Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D. J. Proteome Res. 4:2070-2080(2005) [PubMed: 16335952] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-399, MASS SPECTROMETRY. Tissue: Plasma. |
| [5] | "Identification of N-glycosylation sites on secreted proteins of human hepatocellular carcinoma cells with a complementary proteomics approach." Cao J., Shen C., Wang H., Shen H., Chen Y., Nie A., Yan G., Lu H., Liu Y., Yang P. J. Proteome Res. 8:662-672(2009) [PubMed: 19196183] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-437 AND ASN-455, MASS SPECTROMETRY. |
Cross-references
Sequence databases | |
|---|---|
| D31784 mRNA. Translation: BAA06562.1. BC000019 mRNA. Translation: AAH00019.1. | |
| IPI | IPI00024035. IPI00217314. |
| PIR | I37016. |
| RefSeq | NP_004923.1. |
| UniGene | Hs.171054 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1I7W based on UniProtKB P09803. |
| SMR | P55285. Positions 716-781. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | P55285. |
Proteomic databases | |
| PRIDE | P55285. |
Genome annotation databases | |
| Ensembl | ENSG00000113361. Homo sapiens. [Contig view] |
| GeneID | 1004. |
| KEGG | hsa:1004. |
Organism-specific databases | |
| GeneCards | GC05P031229. |
| H-InvDB | HIX0004778. |
| HGNC | HGNC:1765. CDH6. |
| HPA | HPA007047. HPA007456. |
| MIM | 603007. gene. |
| PharmGKB | PA26302. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOGENOM | P55285. |
| HOVERGEN | P55285. |
| OMA | P55285. RHEMSTY. |
Gene expression databases | |
| ArrayExpress | P55285. |
| Bgee | P55285. |
| CleanEx | HS_CDH6. |
| GermOnline | ENSG00000113361. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR002126. Cadherin. IPR000233. Cadherin_C_term. [Graphical view] |
| Gene3D | G3DSA:2.60.40.60. Cadherin. 5 hits. |
| Pfam | PF00028. Cadherin. 5 hits. PF01049. Cadherin_C. 1 hit. [Graphical view] |
| PRINTS | PR00205. CADHERIN. |
| SMART | SM00112. CA. 5 hits. [Graphical view] |
| PROSITE | PS00232. CADHERIN_1. 3 hits. PS50268. CADHERIN_2. 5 hits. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 4220. |
| SOURCE | Search... |
Entry information
| Entry name | CADH6_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P55285 Secondary accession number(s): Q9BWS0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 5 Human chromosome 5: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


