Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P55285

- CADH6_HUMAN

UniProt

P55285 - CADH6_HUMAN

Protein

Cadherin-6

Gene

CDH6

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 129 (01 Oct 2014)
      Sequence version 1 (01 Oct 1996)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types.

    GO - Molecular functioni

    1. calcium ion binding Source: InterPro

    GO - Biological processi

    1. adherens junction organization Source: Reactome
    2. cell adhesion Source: ProtInc
    3. cell-cell junction organization Source: Reactome
    4. cell junction assembly Source: Reactome
    5. homophilic cell adhesion Source: InterPro

    Keywords - Biological processi

    Cell adhesion

    Keywords - Ligandi

    Calcium, Metal-binding

    Enzyme and pathway databases

    ReactomeiREACT_19195. Adherens junctions interactions.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Cadherin-6
    Alternative name(s):
    Kidney cadherin
    Short name:
    K-cadherin
    Gene namesi
    Name:CDH6
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 5

    Organism-specific databases

    HGNCiHGNC:1765. CDH6.

    Subcellular locationi

    GO - Cellular componenti

    1. extracellular vesicular exosome Source: UniProt
    2. integral component of membrane Source: UniProtKB-KW
    3. plasma membrane Source: Reactome

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA26302.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 1818Sequence AnalysisAdd
    BLAST
    Propeptidei19 – 5335Sequence AnalysisPRO_0000003761Add
    BLAST
    Chaini54 – 790737Cadherin-6PRO_0000003762Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi49 – 491N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi255 – 2551N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi399 – 3991N-linked (GlcNAc...)1 Publication
    Glycosylationi437 – 4371N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi455 – 4551N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi536 – 5361N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Cleavage on pair of basic residues, Glycoprotein

    Proteomic databases

    PaxDbiP55285.
    PRIDEiP55285.

    PTM databases

    PhosphoSiteiP55285.

    Expressioni

    Tissue specificityi

    Highly expressed in brain, cerebellum, and kidney. Lung, pancreas, and gastric mucosa show a weak expression. Also expressed in certain liver and kidney carcinomas.

    Gene expression databases

    ArrayExpressiP55285.
    BgeeiP55285.
    CleanExiHS_CDH6.
    GenevestigatoriP55285.

    Organism-specific databases

    HPAiCAB025274.
    HPA007047.
    HPA007456.

    Interactioni

    Protein-protein interaction databases

    BioGridi107439. 3 interactions.
    STRINGi9606.ENSP00000265071.

    Structurei

    3D structure databases

    ProteinModelPortaliP55285.
    SMRiP55285. Positions 54-589, 689-783.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini54 – 615562ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini637 – 790154CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei616 – 63621HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini54 – 159106Cadherin 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini160 – 268109Cadherin 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini269 – 383115Cadherin 3PROSITE-ProRule annotationAdd
    BLAST
    Domaini384 – 486103Cadherin 4PROSITE-ProRule annotationAdd
    BLAST
    Domaini487 – 608122Cadherin 5PROSITE-ProRule annotationAdd
    BLAST

    Domaini

    Three calcium ions are usually bound at the interface of each cadherin domain and rigidify the connections, imparting a strong curvature to the full-length ectodomain.By similarity

    Sequence similaritiesi

    Contains 5 cadherin domains.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG257411.
    HOGENOMiHOG000231252.
    HOVERGENiHBG005217.
    InParanoidiP55285.
    KOiK06798.
    OMAiRHEMSTY.
    PhylomeDBiP55285.
    TreeFamiTF329887.

    Family and domain databases

    Gene3Di2.60.40.60. 5 hits.
    4.10.900.10. 1 hit.
    InterProiIPR002126. Cadherin.
    IPR015919. Cadherin-like.
    IPR020894. Cadherin_CS.
    IPR000233. Cadherin_cytoplasmic-dom.
    IPR027397. Catenin_binding_dom.
    [Graphical view]
    PfamiPF00028. Cadherin. 5 hits.
    PF01049. Cadherin_C. 1 hit.
    [Graphical view]
    PRINTSiPR00205. CADHERIN.
    SMARTiSM00112. CA. 5 hits.
    [Graphical view]
    SUPFAMiSSF49313. SSF49313. 5 hits.
    PROSITEiPS00232. CADHERIN_1. 3 hits.
    PS50268. CADHERIN_2. 5 hits.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P55285-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MRTYRYFLLL FWVGQPYPTL STPLSKRTSG FPAKKRALEL SGNSKNELNR    50
    SKRSWMWNQF FLLEEYTGSD YQYVGKLHSD QDRGDGSLKY ILSGDGAGDL 100
    FIINENTGDI QATKRLDREE KPVYILRAQA INRRTGRPVE PESEFIIKIH 150
    DINDNEPIFT KEVYTATVPE MSDVGTFVVQ VTATDADDPT YGNSAKVVYS 200
    ILQGQPYFSV ESETGIIKTA LLNMDRENRE QYQVVIQAKD MGGQMGGLSG 250
    TTTVNITLTD VNDNPPRFPQ STYQFKTPES SPPGTPIGRI KASDADVGEN 300
    AEIEYSITDG EGLDMFDVIT DQETQEGIIT VKKLLDFEKK KVYTLKVEAS 350
    NPYVEPRFLY LGPFKDSATV RIVVEDVDEP PVFSKLAYIL QIREDAQINT 400
    TIGSVTAQDP DAARNPVKYS VDRHTDMDRI FNIDSGNGSI FTSKLLDRET 450
    LLWHNITVIA TEINNPKQSS RVPLYIKVLD VNDNAPEFAE FYETFVCEKA 500
    KADQLIQTLH AVDKDDPYSG HQFSFSLAPE AASGSNFTIQ DNKDNTAGIL 550
    TRKNGYNRHE MSTYLLPVVI SDNDYPVQSS TGTVTVRVCA CDHHGNMQSC 600
    HAEALIHPTG LSTGALVAIL LCIVILLVTV VLFAALRRQR KKEPLIISKE 650
    DIRDNIVSYN DEGGGEEDTQ AFDIGTLRNP EAIEDNKLRR DIVPEALFLP 700
    RRTPTARDNT DVRDFINQRL KENDTDPTAP PYDSLATYAY EGTGSVADSL 750
    SSLESVTTDA DQDYDYLSDW GPRFKKLADM YGGVDSDKDS 790
    Length:790
    Mass (Da):88,309
    Last modified:October 1, 1996 - v1
    Checksum:iC175004FC8A61100
    GO
    Isoform 2 (identifier: P55285-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         628-663: VTVVLFAALRRQRKKEPLIISKEDIRDNIVSYNDEG → GKLVLPASYLPMVRGSHCYCDTLDLSASPIKAYSLI
         664-790: Missing.

    Show »
    Length:663
    Mass (Da):73,864
    Checksum:i97319C50BED1DC28
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti421 – 4211V → I no nucleotide entry (PubMed:2059658)Curated
    Sequence conflicti425 – 4251T → I no nucleotide entry (PubMed:2059658)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei628 – 66336VTVVL…YNDEG → GKLVLPASYLPMVRGSHCYC DTLDLSASPIKAYSLI in isoform 2. 1 PublicationVSP_000636Add
    BLAST
    Alternative sequencei664 – 790127Missing in isoform 2. 1 PublicationVSP_000637Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D31784 mRNA. Translation: BAA06562.1.
    AK291290 mRNA. Translation: BAF83979.1.
    CH471118 Genomic DNA. Translation: EAX10764.1.
    BC000019 mRNA. Translation: AAH00019.1.
    CCDSiCCDS3894.1. [P55285-1]
    PIRiI37016.
    RefSeqiNP_004923.1. NM_004932.3. [P55285-1]
    UniGeneiHs.124776.
    Hs.171054.

    Genome annotation databases

    EnsembliENST00000265071; ENSP00000265071; ENSG00000113361. [P55285-1]
    GeneIDi1004.
    KEGGihsa:1004.
    UCSCiuc003jhd.2. human. [P55285-2]
    uc003jhe.2. human. [P55285-1]

    Polymorphism databases

    DMDMi1705545.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D31784 mRNA. Translation: BAA06562.1 .
    AK291290 mRNA. Translation: BAF83979.1 .
    CH471118 Genomic DNA. Translation: EAX10764.1 .
    BC000019 mRNA. Translation: AAH00019.1 .
    CCDSi CCDS3894.1. [P55285-1 ]
    PIRi I37016.
    RefSeqi NP_004923.1. NM_004932.3. [P55285-1 ]
    UniGenei Hs.124776.
    Hs.171054.

    3D structure databases

    ProteinModelPortali P55285.
    SMRi P55285. Positions 54-589, 689-783.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 107439. 3 interactions.
    STRINGi 9606.ENSP00000265071.

    PTM databases

    PhosphoSitei P55285.

    Polymorphism databases

    DMDMi 1705545.

    Proteomic databases

    PaxDbi P55285.
    PRIDEi P55285.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000265071 ; ENSP00000265071 ; ENSG00000113361 . [P55285-1 ]
    GeneIDi 1004.
    KEGGi hsa:1004.
    UCSCi uc003jhd.2. human. [P55285-2 ]
    uc003jhe.2. human. [P55285-1 ]

    Organism-specific databases

    CTDi 1004.
    GeneCardsi GC05P031229.
    HGNCi HGNC:1765. CDH6.
    HPAi CAB025274.
    HPA007047.
    HPA007456.
    MIMi 603007. gene.
    neXtProti NX_P55285.
    PharmGKBi PA26302.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG257411.
    HOGENOMi HOG000231252.
    HOVERGENi HBG005217.
    InParanoidi P55285.
    KOi K06798.
    OMAi RHEMSTY.
    PhylomeDBi P55285.
    TreeFami TF329887.

    Enzyme and pathway databases

    Reactomei REACT_19195. Adherens junctions interactions.

    Miscellaneous databases

    GeneWikii CDH6.
    GenomeRNAii 1004.
    NextBioi 4220.
    PROi P55285.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P55285.
    Bgeei P55285.
    CleanExi HS_CDH6.
    Genevestigatori P55285.

    Family and domain databases

    Gene3Di 2.60.40.60. 5 hits.
    4.10.900.10. 1 hit.
    InterProi IPR002126. Cadherin.
    IPR015919. Cadherin-like.
    IPR020894. Cadherin_CS.
    IPR000233. Cadherin_cytoplasmic-dom.
    IPR027397. Catenin_binding_dom.
    [Graphical view ]
    Pfami PF00028. Cadherin. 5 hits.
    PF01049. Cadherin_C. 1 hit.
    [Graphical view ]
    PRINTSi PR00205. CADHERIN.
    SMARTi SM00112. CA. 5 hits.
    [Graphical view ]
    SUPFAMi SSF49313. SSF49313. 5 hits.
    PROSITEi PS00232. CADHERIN_1. 3 hits.
    PS50268. CADHERIN_2. 5 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Isolation and sequence analysis of human cadherin-6 complementary DNA for the full coding sequence and its expression in human carcinoma cells."
      Shimoyama Y., Gotoh M., Terasaki T., Kitajima M., Hirohashi S.
      Cancer Res. 55:2206-2211(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Kidney.
    5. "Diversity of the cadherin family: evidence for eight new cadherins in nervous tissue."
      Suzuki S., Sano K., Tanihara H.
      Cell Regul. 2:261-270(1991) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 377-790 (ISOFORM 1).
      Tissue: Fetal brain.
    6. "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry."
      Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D.
      J. Proteome Res. 4:2070-2080(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-399.
      Tissue: Plasma.
    7. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiCADH6_HUMAN
    AccessioniPrimary (citable) accession number: P55285
    Secondary accession number(s): A8K5H5, Q9BWS0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 1, 1996
    Last sequence update: October 1, 1996
    Last modified: October 1, 2014
    This is version 129 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 5
      Human chromosome 5: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3