P55265 (DSRAD_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 131.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Double-stranded RNA-specific adenosine deaminase Short name=DRADA EC=3.5.4.- Alternative name(s): 136 kDa double-stranded RNA-binding protein Short name=p136 Interferon-inducible protein 4 Short name=IFI-4 K88DSRBP | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1226 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Converts multiple adenosines to inosines and creates I/U mismatched base pairs in double-helical RNA substrates without apparent sequence specificity. Has been found to modify more frequently adenosines in AU-rich regions, probably due to the relative ease of melting A/U base pairs as compared to G/C pairs. Functions to modify viral RNA genomes and may be responsible for hypermutation of certain negative-stranded viruses. Edits the messenger RNAs for glutamate receptor (GLUR) subunits by site-selective adenosine deamination. Produces low-level editing at the GLUR-B Q/R site, but edits efficiently at the R/G site and HOTSPOT1. Binds to short interfering RNAs (siRNA) without editing them and suppresses siRNA-mediated RNA interference. Binds to ILF3/NF90 and up-regulates ILF3-mediated gene expression. Ref.12 |
| Subunit structure | Homodimer. Isoform 1 interacts with ILF2/NF45 and ILF3/NF90. Ref.10 Ref.14 |
| Subcellular location | Cytoplasm. Nucleus › nucleolus. Note: Isoform 1 is found predominantly in cytoplasm but appears to shuttle between the cytoplasm and nucleus. Isoform 5 is found exclusively in the nucleolus. Ref.11 |
| Tissue specificity | Ubiquitously expressed, highest levels were found in brain and lung. |
| Induction | Isoform 1 is induced by interferon alpha. Isoform 5 is constitutively expressed. Ref.9 |
| Post-translational modification | Sumoylation reduces RNA-editing activity. |
| Involvement in disease | Defects in ADAR are a cause of dyschromatosis symmetrical hereditaria (DSH) [MIM:127400]; also known as reticulate acropigmentation of Dohi. DSH is a pigmentary genodermatosis of autosomal dominant inheritance characterized by a mixture of hyperpigmented and hypopigmented macules distributed on the dorsal parts of the hands and feet. Ref.26 Ref.27 Ref.28 |
| Sequence similarities | Contains 1 A to I editase domain. Contains 2 DRADA repeats. Contains 3 DRBM (double-stranded RNA-binding) domains. |
| Caution | The N-terminus of isoform 4 has been derived from EST and genomic sequences. |
| Sequence caution | The sequence CAE45853.1 differs from that shown. Reason: Erroneous termination at position 1227. Translated as stop. |
Ontologies
Alternative products
| This entry describes 5 isoforms produced by alternative promoter usage and alternative splicing. [Align] [Select] | |||||||||
| Isoform 1 (identifier: P55265-1) Also known as: ADAR-a; p150; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | |||||||||
| Note: Produced by alternative promoter usage. | |||||||||
| Isoform 2 (identifier: P55265-2) Also known as: ADAR-b; The sequence of this isoform differs from the canonical sequence as follows: 807-832: Missing. | |||||||||
| Note: Produced by alternative splicing of isoform 1. | |||||||||
| Isoform 3 (identifier: P55265-3) Also known as: ADAR-c; The sequence of this isoform differs from the canonical sequence as follows: 694-712: Missing. 807-832: Missing. | |||||||||
| Note: Produced by alternative splicing of isoform 1. | |||||||||
| Isoform 4 (identifier: P55265-4) The sequence of this isoform differs from the canonical sequence as follows: 1-5: MNPRQ → MMSPICDQTIDSRLKVEKATWWGRVGGGSRPHWQPPGVRPCPEEVQDP | |||||||||
| Note: Produced by alternative splicing of isoform 1. No experimental confirmation available. The N-terminus has been derived from EST and genomic sequences. | |||||||||
Sequence annotation (Features) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
| Sequence conflict | 13 | 1 | R → G in CAE45853. Ref.5 | ||||||
| Isoform 5 (identifier: P55265-5) The sequence of this isoform differs from the canonical sequence as follows: 1-295: Missing. | |||||||||
| Note: Produced by alternative promoter usage. | |||||||||
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1226 | 1226 | Double-stranded RNA-specific adenosine deaminase | PRO_0000171774 | |||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||
| Repeat | 133 – 202 | 70 | DRADA 1 | ||||||||||||||||||||||||||||||||||
| Repeat | 293 – 360 | 68 | DRADA 2 | ||||||||||||||||||||||||||||||||||
| Domain | 503 – 571 | 69 | DRBM 1 | ||||||||||||||||||||||||||||||||||
| Domain | 614 – 682 | 69 | DRBM 2 | ||||||||||||||||||||||||||||||||||
| Domain | 726 – 794 | 69 | DRBM 3 | ||||||||||||||||||||||||||||||||||
| Domain | 886 – 1221 | 336 | A to I editase | ||||||||||||||||||||||||||||||||||
| DNA binding | 169 – 195 | 27 | |||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||
| Active site | 912 | 1 | Proton donor By similarity | ||||||||||||||||||||||||||||||||||
| Metal binding | 910 | 1 | Zinc By similarity | ||||||||||||||||||||||||||||||||||
| Metal binding | 966 | 1 | Zinc By similarity | ||||||||||||||||||||||||||||||||||
| Metal binding | 1036 | 1 | Zinc By similarity | ||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||
| Modified residue | 601 | 1 | Phosphothreonine Ref.20 Ref.21 Ref.22 | ||||||||||||||||||||||||||||||||||
| Modified residue | 603 | 1 | Phosphothreonine Ref.22 | ||||||||||||||||||||||||||||||||||
| Modified residue | 614 | 1 | Phosphoserine Ref.20 | ||||||||||||||||||||||||||||||||||
| Modified residue | 808 | 1 | Phosphothreonine Ref.16 Ref.17 Ref.18 Ref.21 Ref.22 | ||||||||||||||||||||||||||||||||||
| Modified residue | 818 | 1 | Phosphothreonine Ref.15 | ||||||||||||||||||||||||||||||||||
| Modified residue | 823 | 1 | Phosphoserine Ref.20 | ||||||||||||||||||||||||||||||||||
| Modified residue | 825 | 1 | Phosphoserine Ref.17 Ref.19 Ref.20 | ||||||||||||||||||||||||||||||||||
| Cross-link | 418 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) Ref.13 | |||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 295 | 295 | Missing in isoform 5. | VSP_019235 | |||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 5 | 5 | MNPRQ → MMSPICDQTIDSRLKVEKAT WWGRVGGGSRPHWQPPGVRP CPEEVQDP in isoform 4. | VSP_008872 | |||||||||||||||||||||||||||||||||
| Alternative sequence | 694 – 712 | 19 | Missing in isoform 3. | VSP_008873 | |||||||||||||||||||||||||||||||||
| Alternative sequence | 807 – 832 | 26 | Missing in isoform 2 and isoform 3. | VSP_008874 | |||||||||||||||||||||||||||||||||
| Natural variant | 100 | 1 | R → G. Ref.1 Ref.2 Ref.3 Ref.4 Ref.5 Ref.8 Corresponds to variant rs1466731 [ dbSNP | Ensembl ]. | VAR_048725 | |||||||||||||||||||||||||||||||||
| Natural variant | 384 | 1 | K → R. Ref.2 Ref.3 Ref.4 Ref.5 Corresponds to variant rs2229857 [ dbSNP | Ensembl ]. | VAR_017240 | |||||||||||||||||||||||||||||||||
| Natural variant | 587 | 1 | Y → C. Corresponds to variant rs17843865 [ dbSNP | Ensembl ]. | VAR_024407 | |||||||||||||||||||||||||||||||||
| Natural variant | 806 | 1 | E → V in a breast cancer sample; somatic mutation. Ref.29 | VAR_035805 | |||||||||||||||||||||||||||||||||
| Natural variant | 923 | 1 | L → P in DSH. Ref.26 Corresponds to variant rs28936680 [ dbSNP | Ensembl ]. | VAR_017604 | |||||||||||||||||||||||||||||||||
| Natural variant | 966 | 1 | C → F in DSH. Ref.27 | VAR_021729 | |||||||||||||||||||||||||||||||||
| Natural variant | 1155 | 1 | R → W in DSH. Ref.28 | VAR_026669 | |||||||||||||||||||||||||||||||||
| Natural variant | 1165 | 1 | F → S in DSH. Ref.26 Corresponds to variant rs28936681 [ dbSNP | Ensembl ]. | VAR_017605 | |||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||
| Mutagenesis | 418 | 1 | K → R: Abolishes sumoylation. Ref.13 | ||||||||||||||||||||||||||||||||||
| Sequence conflict | 53 | 1 | E → G in CAA55968. Ref.4 | ||||||||||||||||||||||||||||||||||
| Sequence conflict | 245 | 1 | F → L in CAE45853. Ref.5 | ||||||||||||||||||||||||||||||||||
| Sequence conflict | 482 | 1 | F → L in CAE45853. Ref.5 | ||||||||||||||||||||||||||||||||||
| Sequence conflict | 873 | 1 | I → V in CAE45853. Ref.5 | ||||||||||||||||||||||||||||||||||
| Sequence conflict | 1093 | 1 | D → G in CAE45853. Ref.5 | ||||||||||||||||||||||||||||||||||
| Sequence conflict | 1184 | 1 | E → K in CAA55967. Ref.4 | ||||||||||||||||||||||||||||||||||
| Sequence conflict | 1184 | 1 | E → K in CAA55968. Ref.4 | ||||||||||||||||||||||||||||||||||
| Sequence conflict | 1184 | 1 | E → K in CAA67169. Ref.4 | ||||||||||||||||||||||||||||||||||
| Sequence conflict | 1184 | 1 | E → K in CAA67170. Ref.4 | ||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||
| Helix | 127 – 130 | 4 | |||||||||||||||||||||||||||||||||||
| Helix | 135 – 150 | 16 | |||||||||||||||||||||||||||||||||||
| Helix | 158 – 165 | 8 | |||||||||||||||||||||||||||||||||||
| Helix | 169 – 181 | 13 | |||||||||||||||||||||||||||||||||||
| Beta strand | 184 – 192 | 9 | |||||||||||||||||||||||||||||||||||
| Beta strand | 194 – 197 | 4 | |||||||||||||||||||||||||||||||||||
| Helix | 294 – 309 | 16 | |||||||||||||||||||||||||||||||||||
| Helix | 315 – 322 | 8 | |||||||||||||||||||||||||||||||||||
| Helix | 324 – 326 | 3 | |||||||||||||||||||||||||||||||||||
| Helix | 327 – 339 | 13 | |||||||||||||||||||||||||||||||||||
| Beta strand | 342 – 346 | 5 | |||||||||||||||||||||||||||||||||||
| Beta strand | 348 – 350 | 3 | |||||||||||||||||||||||||||||||||||
| Beta strand | 352 – 355 | 4 | |||||||||||||||||||||||||||||||||||
| Helix | 357 – 360 | 4 | |||||||||||||||||||||||||||||||||||
| Turn | 361 – 363 | 3 | |||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning of cDNA for double-stranded RNA adenosine deaminase, a candidate enzyme for nuclear RNA editing." Kim U., Wang Y., Sanford T., Zeng Y., Nishikura K. Proc. Natl. Acad. Sci. U.S.A. 91:11457-11461(1994) [PubMed: 7972084] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PARTIAL PROTEIN SEQUENCE, VARIANT GLY-100. |
| [2] | "Expression and regulation by interferon of a double-stranded-RNA-specific adenosine deaminase from human cells: evidence for two forms of the deaminase." Patterson J.B., Samuel C.E. Mol. Cell. Biol. 15:5376-5388(1995) [PubMed: 7565688] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS GLY-100 AND ARG-384. Tissue: Kidney. |
| [3] | "Functionally distinct double-stranded RNA-binding domains associated with alternative splice site variants of the interferon-inducible double-stranded RNA-specific adenosine deaminase." Liu Y., George C.X., Patterson J.B., Samuel C.E. J. Biol. Chem. 272:4419-4428(1997) [PubMed: 9020165] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1; 2 AND 3), VARIANTS GLY-100 AND ARG-384. Tissue: Placenta. |
| [4] | "The gene coding for the interferon-inducible human dsRNA adenosine deaminase is transcribed into several messengers specifying different proteins." Deblandre G., Marinx O., Nols C., Defrance P., Berr P., Huez G., Caput D. Submitted (JUN-1996) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 5), VARIANTS GLY-100 AND ARG-384. Tissue: Cervix carcinoma. |
| [5] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), VARIANTS GLY-100 AND ARG-384. Tissue: Amygdala and Fetal kidney. |
| [6] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed: 16710414] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT GLY-100. Tissue: Lymph. |
| [9] | "Human RNA-specific adenosine deaminase ADAR1 transcripts possess alternative exon 1 structures that initiate from different promoters, one constitutively active and the other interferon inducible." George C.X., Samuel C.E. Proc. Natl. Acad. Sci. U.S.A. 96:4621-4626(1999) [PubMed: 10200312] [Abstract] Cited for: ALTERNATIVE PROMOTER USAGE, INDUCTION. |
| [10] | "Requirement of dimerization for RNA editing activity of adenosine deaminases acting on RNA." Cho D.-S.C., Yang W., Lee J.T., Shiekhattar R., Murray J.M., Nishikura K. J. Biol. Chem. 278:17093-17102(2003) [PubMed: 12618436] [Abstract] Cited for: HOMODIMERIZATION. |
| [11] | "Dynamic association of RNA-editing enzymes with the nucleolus." Desterro J.M.P., Keegan L.P., Lafarga M., Berciano M.T., O'Connell M., Carmo-Fonseca M. J. Cell Sci. 116:1805-1818(2003) [PubMed: 12665561] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [12] | "ADAR1 RNA deaminase limits short interfering RNA efficacy in mammalian cells." Yang W., Wang Q., Howell K.L., Lee J.T., Cho D.-S.C., Murray J.M., Nishikura K. J. Biol. Chem. 280:3946-3953(2005) [PubMed: 15556947] [Abstract] Cited for: FUNCTION. |
| [13] | "SUMO-1 modification alters ADAR1 editing activity." Desterro J.M.P., Keegan L.P., Jaffray E., Hay R.T., O'Connell M.A., Carmo-Fonseca M. Mol. Biol. Cell 16:5115-5126(2005) [PubMed: 16120648] [Abstract] Cited for: SUMOYLATION AT LYS-418, MUTAGENESIS OF LYS-418. |
| [14] | "ADAR1 interacts with NF90 through double-stranded RNA and regulates NF90-mediated gene expression independently of RNA editing." Nie Y., Ding L., Kao P.N., Braun R., Yang J.-H. Mol. Cell. Biol. 25:6956-6963(2005) [PubMed: 16055709] [Abstract] Cited for: INTERACTION WITH ILF2 AND ILF3. |
| [15] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed: 17081983] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-818, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [16] | "A probability-based approach for high-throughput protein phosphorylation analysis and site localization." Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. Nat. Biotechnol. 24:1285-1292(2006) [PubMed: 16964243] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-808, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [17] | "Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra." Yu L.-R., Zhu Z., Chan K.C., Issaq H.J., Dimitrov D.S., Veenstra T.D. J. Proteome Res. 6:4150-4162(2007) [PubMed: 17924679] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-808 AND SER-825, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [18] | "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis." Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III J. Proteome Res. 7:1346-1351(2008) [PubMed: 18220336] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-808, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [19] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed: 18691976] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-825, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [20] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-601; SER-614; SER-823 AND SER-825, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [21] | "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501(2009) [PubMed: 19413330] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-601 AND THR-808, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [22] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed: 19690332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-601; THR-603 AND THR-808, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [23] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed: 21269460] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [24] | "Crystal structure of the Z alpha domain of the human editing enzyme ADAR1 bound to left-handed Z-DNA." Schwartz T., Rould M.A., Lowenhaupt K., Herbert A., Rich A. Science 284:1841-1845(1999) [PubMed: 10364558] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.1 ANGSTROMS) OF 133-209 IN COMPLEX WITH Z-DNA. |
| [25] | "The solution structure of the Zalpha domain of the human RNA editing enzyme ADAR1 reveals a prepositioned binding surface for Z-DNA." Schade M., Turner C.J., Kuehne R., Schmieder P., Lowenhaupt K., Herbert A., Rich A., Oschkinat H. Proc. Natl. Acad. Sci. U.S.A. 96:12465-12470(1999) [PubMed: 10535945] [Abstract] Cited for: STRUCTURE BY NMR OF 125-201 IN COMPLEX WITH Z-DNA AND ALONE. |
| [26] | "Mutations of the RNA-specific adenosine deaminase gene (DSRAD) are involved in dyschromatosis symmetrica hereditaria." Miyamura Y., Suzuki T., Kono M., Inagaki K., Ito S., Suzuki N., Tomita Y. Am. J. Hum. Genet. 73:693-699(2003) [PubMed: 12916015] [Abstract] Cited for: VARIANTS DSH PRO-923 AND SER-1165. |
| [27] | "Seven novel mutations of the ADAR gene in Chinese families and sporadic patients with dyschromatosis symmetrica hereditaria (DSH)." Zhang X.-J., He P.-P., Li M., He C.-D., Yan K.-L., Cui Y., Yang S., Zhang K.-Y., Gao M., Chen J.-J., Li C.-R., Jin L., Chen H.-D., Xu S.-J., Huang W. Hum. Mutat. 23:629-630(2004) [PubMed: 15146470] [Abstract] Cited for: VARIANT DSH PHE-966. |
| [28] | "A new arginine substitution mutation of DSRAD gene in a Chinese family with dyschromatosis symmetrica hereditaria." Li C.-R., Li M., Ma H.-J., Luo D., Yang L.-J., Wang D.-G., Zhu X.-H., Yue X.-Z., Chen W.-Q., Zhu W.-Y. J. Dermatol. Sci. 37:95-99(2005) [PubMed: 15659327] [Abstract] Cited for: VARIANT DSH TRP-1155. |
| [29] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed: 16959974] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] VAL-806. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U10439 mRNA. Translation: AAB06697.1. U75503 U75502 Genomic DNA. Translation: AAB97116.1.U75503 U75502 Genomic DNA. Translation: AAB97117.1.U75503 U75502 Genomic DNA. Translation: AAB97118.1.U18121 mRNA. Translation: AAC13782.1. X79448 mRNA. Translation: CAA55967.1. X79449 mRNA. Translation: CAA55968.1. X98559 mRNA. Translation: CAA67169.1. X98559 mRNA. Translation: CAA67170.1. BX538232 mRNA. Translation: CAD98075.1. BX640741 mRNA. Translation: CAE45853.1. Sequence problems. AL606500, AL592078, AL691488 Genomic DNA. Translation: CAH71907.1. AL606500, AL592078, AL691488 Genomic DNA. Translation: CAH71908.1. AL592078, AL606500, AL691488 Genomic DNA. Translation: CAI16183.1. AL592078, AL606500, AL691488 Genomic DNA. Translation: CAI16185.1. AL691488, AL592078, AL606500 Genomic DNA. Translation: CAI17375.1. AL691488, AL592078, AL606500 Genomic DNA. Translation: CAI17376.1. CH471121 Genomic DNA. Translation: EAW53183.1. CH471121 Genomic DNA. Translation: EAW53187.1. BC038227 mRNA. Translation: AAH38227.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00025057. IPI00025058. IPI00394665. IPI00394668. IPI00760588. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | S65593. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001020278.1. NM_001025107.2. NP_001102.2. NM_001111.4. NP_001180424.1. NM_001193495.1. NP_056655.2. NM_015840.3. NP_056656.2. NM_015841.3. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.12341. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | P55265. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMR | P55265. Positions 126-200, 294-366, 500-795, 829-1224. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DIP | DIP-29310N. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | P55265. 3 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | P55265. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | P55265. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | P55265. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000368474; ENSP00000357459; ENSG00000160710. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 103. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:103. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc001ffi.1. human. uc001ffj.1. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 103. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC01M154554. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:225. ADAR. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | HPA003890. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 127400. phenotype. 146920. gene. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_P55265. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Orphanet | 41. Acropigmentation of Dohi. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA24555. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneTree | ENSGT00550000074412. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG067087. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG4HDSSW. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_1675. mRNA Processing. REACT_6900. Immune System. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | P55265. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | P55265. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_ADAR. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | P55265. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000160710. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR002466. A_deamin. IPR001159. Ds-RNA-bd. IPR014720. dsRNA-bd-like. IPR000607. dsRNA_A_deaminase. IPR011991. WHTH_trsnscrt_rep_DNA-bd. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene3D | G3DSA:3.30.160.20. dsRNA-bd-like. 3 hits. G3DSA:1.10.10.10. Wing_hlx_DNA_bd. 2 hits. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KO | K12968. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF02137. A_deamin. 1 hit. PF00035. dsrm. 3 hits. PF02295. z-alpha. 2 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00552. ADEAMc. 1 hit. SM00358. DSRM. 3 hits. SM00550. Zalpha. 2 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS50141. A_DEAMIN_EDITASE. 1 hit. PS50139. DRADA_REPEAT. 2 hits. PS50137. DS_RBD. 3 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 389. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PMAP-CutDB | P55265. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | DSRAD_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P55265 Secondary accession number(s): B1AQQ9 Q9BYM4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with