P55265 (DSRAD_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 147.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Double-stranded RNA-specific adenosine deaminase Short name=DRADA EC=3.5.4.- Alternative name(s): 136 kDa double-stranded RNA-binding protein Short name=p136 Interferon-inducible protein 4 Short name=IFI-4 K88DSRBP | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1226 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Catalyzes the hydrolytic deamination of adenosine to inosine in double-stranded RNA (dsRNA) referred to as A-to-I RNA editing. This may affect gene expression and function in a number of ways that include mRNA translation by changing codons and hence the amino acid sequence of proteins; pre-mRNA splicing by altering splice site recognition sequences; RNA stability by changing sequences involved in nuclease recognition; genetic stability in the case of RNA virus genomes by changing sequences during viral RNA replication; and RNA structure-dependent activities such as microRNA production or targeting or protein-RNA interactions. Can edit both viral and cellular RNAs and can edit RNAs at multiple sites (hyper-editing) or at specific sites (site-specific editing). Its cellular RNA substrates include: bladder cancer-associated protein (BLCAP), neurotransmitter receptors for glutamate (GRIA2) and serotonin (HTR2C) and GABA receptor (GABRA3). Site-specific RNA editing of transcripts encoding these proteins results in amino acid substitutions which consequently alters their functional activities. Exhibits low-level editing at the GRIA2 Q/R site, but edits efficiently at the R/G site and HOTSPOT1. Its viral RNA substrates include: hepatitis C virus (HCV), vesicular stomatitis virus (VSV), measles virus (MV), hepatitis delta virus (HDV), and human immunodeficiency virus type 1 (HIV-1). Exhibits either a proviral (HDV, MV, VSV and HIV-1) or an antiviral effect (HCV) and this can be editing-dependent (HDV and HCV), editing-independent (VSV and MV) or both (HIV-1). Impairs HCV replication via RNA editing at multiple sites. Enhances the replication of MV, VSV and HIV-1 through an editing-independent mechanism via suppression of EIF2AK2/PKR activation and function. Stimulates both the release and infectivity of HIV-1 viral particles by an editing-dependent mechanism where it associates with viral RNAs and edits adenosines in the 5'UTR and the Rev and Tat coding sequence. Can enhance viral replication of HDV via A-to-I editing at a site designated as amber/W, thereby changing an UAG amber stop codon to an UIG tryptophan (W) codon that permits synthesis of the large delta antigen (L-HDAg) which has a key role in the assembly of viral particles. However, high levels of ADAR1 inhibit HDV replication. Ref.12 Ref.13 Ref.16 Ref.19 Ref.24 Ref.25 Ref.27 Ref.30 Ref.34 Ref.41 |
| Subunit structure | Homodimer. Homodimerization is essential for its catalytic activity. Isoform 5 can form heterodimers with ADARB1/ADAR2. Isoform 1 interacts with ILF2/NF45 and ILF3/NF90. Binding to ILF3/NF90 up-regulates ILF3-mediated gene expression. Isoform 5 (via DRBM 3 domain) interacts with TNPO1. Isoform 5 (via DRBM domains) interacts with XPO5. Isoform 1 and isoform 5 can interact with EIF2AK2/PKR and UPF1. Ref.10 Ref.15 Ref.19 Ref.20 Ref.23 Ref.25 Ref.26 |
| Subcellular location | Isoform 1: Cytoplasm. Nucleus. Note: Shuttles between the cytoplasm and nucleus. Ref.11 Ref.23 Ref.26 Isoform 5: Cytoplasm. Nucleus. Nucleus › nucleolus. Note: Predominantly nuclear but can shuttle between nucleus and cytoplasm. TNPO1 can mediate its nuclear import whereas XPO1 can mediate its nuclear export. Ref.11 Ref.23 Ref.26 |
| Tissue specificity | Ubiquitously expressed, highest levels were found in brain and lung. Isoform 5 is expressed at higher levels in astrocytomas as compared to normal brain tissue and expression increases strikingly with the severity of the tumor, being higher in the most aggressive tumors. Ref.20 |
| Induction | Isoform 1 is induced by interferon alpha. Isoform 5 is constitutively expressed. Ref.9 |
| Post-translational modification | Sumoylation reduces RNA-editing activity. Ref.14 |
| Involvement in disease | Dyschromatosis symmetrical hereditaria (DSH) [MIM:127400]: Pigmentary genodermatosis of autosomal dominant inheritance characterized by a mixture of hyperpigmented and hypopigmented macules distributed on the dorsal parts of the hands and feet. |
| Sequence similarities | Contains 1 A to I editase domain. Contains 2 DRADA repeats. Contains 3 DRBM (double-stranded RNA-binding) domains. |
| Caution | The N-terminus of isoform 4 has been derived from EST and genomic sequences. |
| Sequence caution | The sequence CAE45853.1 differs from that shown. Reason: Erroneous termination at position 1227. Translated as stop. |
Ontologies
Alternative products
| This entry describes 5 isoforms produced by alternative promoter usage and alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P55265-1) Also known as: ADAR-a; ADAR1L; p150; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: Produced by alternative promoter usage. | ||||||
| Isoform 2 (identifier: P55265-2) Also known as: ADAR-b; The sequence of this isoform differs from the canonical sequence as follows: 807-832: Missing. | ||||||
| Note: Produced by alternative splicing of isoform 1. | ||||||
| Isoform 3 (identifier: P55265-3) Also known as: ADAR-c; The sequence of this isoform differs from the canonical sequence as follows: 694-712: Missing. 807-832: Missing. | ||||||
| Note: Produced by alternative splicing of isoform 1. | ||||||
| Isoform 4 (identifier: P55265-4) The sequence of this isoform differs from the canonical sequence as follows: 1-5: MNPRQ → MMSPICDQTIDSRLKVEKATWWGRVGGGSRPHWQPPGVRPCPEEVQDP | ||||||
| Note: Produced by alternative splicing of isoform 1. No experimental confirmation available. The N-terminus has been derived from EST and genomic sequences. | ||||||
| Isoform 5 (identifier: P55265-5) Also known as: ADAR1S; p110; The sequence of this isoform differs from the canonical sequence as follows: 1-295: Missing. | ||||||
| Note: Produced by alternative promoter usage. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1226 | 1226 | Double-stranded RNA-specific adenosine deaminase | PRO_0000171774 | |||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||
| Repeat | 133 – 202 | 70 | DRADA 1 | ||||||||||||||||||||||||||||||||||||
| Repeat | 293 – 360 | 68 | DRADA 2 | ||||||||||||||||||||||||||||||||||||
| Domain | 503 – 571 | 69 | DRBM 1 | ||||||||||||||||||||||||||||||||||||
| Domain | 614 – 682 | 69 | DRBM 2 | ||||||||||||||||||||||||||||||||||||
| Domain | 726 – 794 | 69 | DRBM 3 | ||||||||||||||||||||||||||||||||||||
| Domain | 886 – 1221 | 336 | A to I editase | ||||||||||||||||||||||||||||||||||||
| DNA binding | 169 – 195 | 27 | |||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||
| Active site | 912 | 1 | Proton donor By similarity | ||||||||||||||||||||||||||||||||||||
| Metal binding | 910 | 1 | Zinc By similarity | ||||||||||||||||||||||||||||||||||||
| Metal binding | 966 | 1 | Zinc By similarity | ||||||||||||||||||||||||||||||||||||
| Metal binding | 1036 | 1 | Zinc By similarity | ||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 601 | 1 | Phosphothreonine Ref.22 Ref.28 | ||||||||||||||||||||||||||||||||||||
| Modified residue | 614 | 1 | Phosphoserine Ref.22 | ||||||||||||||||||||||||||||||||||||
| Modified residue | 808 | 1 | Phosphothreonine Ref.17 Ref.18 Ref.21 Ref.28 Ref.31 | ||||||||||||||||||||||||||||||||||||
| Modified residue | 823 | 1 | Phosphoserine Ref.22 | ||||||||||||||||||||||||||||||||||||
| Modified residue | 825 | 1 | Phosphoserine Ref.22 Ref.31 Ref.37 | ||||||||||||||||||||||||||||||||||||
| Cross-link | 418 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) Ref.14 | |||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 295 | 295 | Missing in isoform 5. | VSP_019235 | |||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 5 | 5 | MNPRQ → MMSPICDQTIDSRLKVEKAT WWGRVGGGSRPHWQPPGVRP CPEEVQDP in isoform 4. | VSP_008872 | |||||||||||||||||||||||||||||||||||
| Alternative sequence | 694 – 712 | 19 | Missing in isoform 3. | VSP_008873 | |||||||||||||||||||||||||||||||||||
| Alternative sequence | 807 – 832 | 26 | Missing in isoform 2 and isoform 3. | VSP_008874 | |||||||||||||||||||||||||||||||||||
| Natural variant | 100 | 1 | R → G. Ref.1 Ref.2 Ref.3 Ref.4 Ref.5 Ref.8 Corresponds to variant rs1466731 [ dbSNP | Ensembl ]. | VAR_048725 | |||||||||||||||||||||||||||||||||||
| Natural variant | 384 | 1 | K → R. Ref.2 Ref.3 Ref.4 Ref.5 Corresponds to variant rs2229857 [ dbSNP | Ensembl ]. | VAR_017240 | |||||||||||||||||||||||||||||||||||
| Natural variant | 587 | 1 | Y → C. Corresponds to variant rs17843865 [ dbSNP | Ensembl ]. | VAR_024407 | |||||||||||||||||||||||||||||||||||
| Natural variant | 806 | 1 | E → V in a breast cancer sample; somatic mutation. Ref.48 | VAR_035805 | |||||||||||||||||||||||||||||||||||
| Natural variant | 923 | 1 | L → P in DSH. Ref.45 Corresponds to variant rs28936680 [ dbSNP | Ensembl ]. | VAR_017604 | |||||||||||||||||||||||||||||||||||
| Natural variant | 966 | 1 | C → F in DSH. Ref.46 | VAR_021729 | |||||||||||||||||||||||||||||||||||
| Natural variant | 1155 | 1 | R → W in DSH. Ref.47 | VAR_026669 | |||||||||||||||||||||||||||||||||||
| Natural variant | 1165 | 1 | F → S in DSH. Ref.45 Corresponds to variant rs28936681 [ dbSNP | Ensembl ]. | VAR_017605 | |||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 418 | 1 | K → R: Abolishes sumoylation. Ref.14 | ||||||||||||||||||||||||||||||||||||
| Sequence conflict | 53 | 1 | E → G in CAA55968. Ref.4 | ||||||||||||||||||||||||||||||||||||
| Sequence conflict | 245 | 1 | F → L in CAE45853. Ref.5 | ||||||||||||||||||||||||||||||||||||
| Sequence conflict | 482 | 1 | F → L in CAE45853. Ref.5 | ||||||||||||||||||||||||||||||||||||
| Sequence conflict | 873 | 1 | I → V in CAE45853. Ref.5 | ||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1093 | 1 | D → G in CAE45853. Ref.5 | ||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1184 | 1 | E → K in CAA55967. Ref.4 | ||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1184 | 1 | E → K in CAA55968. Ref.4 | ||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1184 | 1 | E → K in CAA67169. Ref.4 | ||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1184 | 1 | E → K in CAA67170. Ref.4 | ||||||||||||||||||||||||||||||||||||
| Isoform 4: | |||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 13 | 1 | R → G in CAE45853. Ref.5 | ||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||
| Helix | 127 – 130 | 4 | |||||||||||||||||||||||||||||||||||||
| Helix | 135 – 150 | 16 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 152 – 154 | 3 | |||||||||||||||||||||||||||||||||||||
| Helix | 158 – 165 | 8 | |||||||||||||||||||||||||||||||||||||
| Helix | 169 – 181 | 13 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 184 – 192 | 9 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 194 – 197 | 4 | |||||||||||||||||||||||||||||||||||||
| Helix | 294 – 309 | 16 | |||||||||||||||||||||||||||||||||||||
| Helix | 315 – 322 | 8 | |||||||||||||||||||||||||||||||||||||
| Helix | 324 – 326 | 3 | |||||||||||||||||||||||||||||||||||||
| Helix | 327 – 339 | 13 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 342 – 346 | 5 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 348 – 350 | 3 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 352 – 355 | 4 | |||||||||||||||||||||||||||||||||||||
| Helix | 357 – 360 | 4 | |||||||||||||||||||||||||||||||||||||
| Turn | 361 – 363 | 3 | |||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning of cDNA for double-stranded RNA adenosine deaminase, a candidate enzyme for nuclear RNA editing." Kim U., Wang Y., Sanford T., Zeng Y., Nishikura K. Proc. Natl. Acad. Sci. U.S.A. 91:11457-11461(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PARTIAL PROTEIN SEQUENCE, VARIANT GLY-100. |
| [2] | "Expression and regulation by interferon of a double-stranded-RNA-specific adenosine deaminase from human cells: evidence for two forms of the deaminase." Patterson J.B., Samuel C.E. Mol. Cell. Biol. 15:5376-5388(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS GLY-100 AND ARG-384. Tissue: Kidney. |
| [3] | "Functionally distinct double-stranded RNA-binding domains associated with alternative splice site variants of the interferon-inducible double-stranded RNA-specific adenosine deaminase." Liu Y., George C.X., Patterson J.B., Samuel C.E. J. Biol. Chem. 272:4419-4428(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1; 2 AND 3), VARIANTS GLY-100 AND ARG-384. Tissue: Placenta. |
| [4] | "The gene coding for the interferon-inducible human dsRNA adenosine deaminase is transcribed into several messengers specifying different proteins." Deblandre G., Marinx O., Nols C., Defrance P., Berr P., Huez G., Caput D. Submitted (JUN-1996) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 5), VARIANTS GLY-100 AND ARG-384. Tissue: Cervix carcinoma. |
| [5] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), VARIANTS GLY-100 AND ARG-384. Tissue: Amygdala and Fetal kidney. |
| [6] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT GLY-100. Tissue: Lymph. |
| [9] | "Human RNA-specific adenosine deaminase ADAR1 transcripts possess alternative exon 1 structures that initiate from different promoters, one constitutively active and the other interferon inducible." George C.X., Samuel C.E. Proc. Natl. Acad. Sci. U.S.A. 96:4621-4626(1999) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE PROMOTER USAGE, INDUCTION. |
| [10] | "Requirement of dimerization for RNA editing activity of adenosine deaminases acting on RNA." Cho D.-S.C., Yang W., Lee J.T., Shiekhattar R., Murray J.M., Nishikura K. J. Biol. Chem. 278:17093-17102(2003) [PubMed] [Europe PMC] [Abstract] Cited for: HOMODIMERIZATION. |
| [11] | "Dynamic association of RNA-editing enzymes with the nucleolus." Desterro J.M.P., Keegan L.P., Lafarga M., Berciano M.T., O'Connell M., Carmo-Fonseca M. J. Cell Sci. 116:1805-1818(2003) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [12] | "ADAR1 RNA deaminase limits short interfering RNA efficacy in mammalian cells." Yang W., Wang Q., Howell K.L., Lee J.T., Cho D.-S.C., Murray J.M., Nishikura K. J. Biol. Chem. 280:3946-3953(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [13] | "New antiviral pathway that mediates hepatitis C virus replicon interferon sensitivity through ADAR1." Taylor D.R., Puig M., Darnell M.E., Mihalik K., Feinstone S.M. J. Virol. 79:6291-6298(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [14] | "SUMO-1 modification alters ADAR1 editing activity." Desterro J.M.P., Keegan L.P., Jaffray E., Hay R.T., O'Connell M.A., Carmo-Fonseca M. Mol. Biol. Cell 16:5115-5126(2005) [PubMed] [Europe PMC] [Abstract] Cited for: SUMOYLATION AT LYS-418, MUTAGENESIS OF LYS-418. |
| [15] | "ADAR1 interacts with NF90 through double-stranded RNA and regulates NF90-mediated gene expression independently of RNA editing." Nie Y., Ding L., Kao P.N., Braun R., Yang J.-H. Mol. Cell. Biol. 25:6956-6963(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH ILF2 AND ILF3. |
| [16] | "The large form of ADAR 1 is responsible for enhanced hepatitis delta virus RNA editing in interferon-alpha-stimulated host cells." Hartwig D., Schuette C., Warnecke J., Dorn I., Hennig H., Kirchner H., Schlenke P. J. Viral Hepat. 13:150-157(2006) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [17] | "A probability-based approach for high-throughput protein phosphorylation analysis and site localization." Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-808, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [18] | "Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra." Yu L.-R., Zhu Z., Chan K.C., Issaq H.J., Dimitrov D.S., Veenstra T.D. J. Proteome Res. 6:4150-4162(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-808, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [19] | "Double-stranded RNA deaminase ADAR1 increases host susceptibility to virus infection." Nie Y., Hammond G.L., Yang J.H. J. Virol. 81:917-923(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH EIF2AK2. |
| [20] | "Down-regulation of RNA editing in pediatric astrocytomas: ADAR2 editing activity inhibits cell migration and proliferation." Cenci C., Barzotti R., Galeano F., Corbelli S., Rota R., Massimi L., Di Rocco C., O'Connell M.A., Gallo A. J. Biol. Chem. 283:7251-7260(2008) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE SPLICING, SUBUNIT, TISSUE SPECIFICITY. |
| [21] | "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis." Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-808, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [22] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-601; SER-614; SER-823 AND SER-825, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [23] | "The editing enzyme ADAR1 and the mRNA surveillance protein hUpf1 interact in the cell nucleus." Agranat L., Raitskin O., Sperling J., Sperling R. Proc. Natl. Acad. Sci. U.S.A. 105:5028-5033(2008) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH UPF1, SUBCELLULAR LOCATION. |
| [24] | "RNA-specific adenosine deaminase ADAR1 suppresses measles virus-induced apoptosis and activation of protein kinase PKR." Toth A.M., Li Z., Cattaneo R., Samuel C.E. J. Biol. Chem. 284:29350-29356(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [25] | "ADAR1 interacts with PKR during human immunodeficiency virus infection of lymphocytes and contributes to viral replication." Clerzius G., Gelinas J.F., Daher A., Bonnet M., Meurs E.F., Gatignol A. J. Virol. 83:10119-10128(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH EIF2AK2. |
| [26] | "RNA-regulated interaction of transportin-1 and exportin-5 with the double-stranded RNA-binding domain regulates nucleocytoplasmic shuttling of ADAR1." Fritz J., Strehblow A., Taschner A., Schopoff S., Pasierbek P., Jantsch M.F. Mol. Cell. Biol. 29:1487-1497(2009) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, INTERACTION WITH TNFO1 AND XPO1. |
| [27] | "Editing of HIV-1 RNA by the double-stranded RNA deaminase ADAR1 stimulates viral infection." Doria M., Neri F., Gallo A., Farace M.G., Michienzi A. Nucleic Acids Res. 37:5848-5858(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [28] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-601 AND THR-808, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [29] | "Functions and regulation of RNA editing by ADAR deaminases." Nishikura K. Annu. Rev. Biochem. 79:321-349(2010) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW. |
| [30] | "Human BLCAP transcript: new editing events in normal and cancerous tissues." Galeano F., Leroy A., Rossetti C., Gromova I., Gautier P., Keegan L.P., Massimi L., Di Rocco C., O'Connell M.A., Gallo A. Int. J. Cancer 127:127-137(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [31] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-808 AND SER-825, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [32] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [33] | "RNA editing catalyzed by ADAR1 and its function in mammalian cells." Wang Q. Biokhimiia 76:900-911(2011) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW. |
| [34] | "ADAR2 editing enzyme is a novel human immunodeficiency virus-1 proviral factor." Doria M., Tomaselli S., Neri F., Ciafre S.A., Farace M.G., Michienzi A., Gallo A. J. Gen. Virol. 92:1228-1232(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [35] | "Adenosine deaminases acting on RNA, RNA editing, and interferon action." George C.X., Gan Z., Liu Y., Samuel C.E. J. Interferon Cytokine Res. 31:99-117(2011) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW. |
| [36] | "Enhancement of replication of RNA viruses by ADAR1 via RNA editing and inhibition of RNA-activated protein kinase." Gelinas J.F., Clerzius G., Shaw E., Gatignol A. J. Virol. 85:8460-8466(2011) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW. |
| [37] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-825, MASS SPECTROMETRY. |
| [38] | "Adenosine deaminases acting on RNA (ADARs) are both antiviral and proviral." Samuel C.E. Virology 411:180-193(2011) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW. |
| [39] | "A-to-I editing of protein coding and noncoding RNAs." Mallela A., Nishikura K. Crit. Rev. Biochem. Mol. Biol. 47:493-501(2012) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW. |
| [40] | "ADAR proteins: structure and catalytic mechanism." Goodman R.A., Macbeth M.R., Beal P.A. Curr. Top. Microbiol. Immunol. 353:1-33(2012) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW. |
| [41] | "Adenosine deaminase acting on RNA 1 (ADAR1) suppresses the induction of interferon by measles virus." Li Z., Okonski K.M., Samuel C.E. J. Virol. 86:3787-3794(2012) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [42] | "Activity regulation of adenosine deaminases acting on RNA (ADARs)." Orlandi C., Barbon A., Barlati S. Mol. Neurobiol. 45:61-75(2012) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW. |
| [43] | "Crystal structure of the Z alpha domain of the human editing enzyme ADAR1 bound to left-handed Z-DNA." Schwartz T., Rould M.A., Lowenhaupt K., Herbert A., Rich A. Science 284:1841-1845(1999) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.1 ANGSTROMS) OF 133-209 IN COMPLEX WITH Z-DNA. |
| [44] | "The solution structure of the Zalpha domain of the human RNA editing enzyme ADAR1 reveals a prepositioned binding surface for Z-DNA." Schade M., Turner C.J., Kuehne R., Schmieder P., Lowenhaupt K., Herbert A., Rich A., Oschkinat H. Proc. Natl. Acad. Sci. U.S.A. 96:12465-12470(1999) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 125-201 IN COMPLEX WITH Z-DNA AND ALONE. |
| [45] | "Mutations of the RNA-specific adenosine deaminase gene (DSRAD) are involved in dyschromatosis symmetrica hereditaria." Miyamura Y., Suzuki T., Kono M., Inagaki K., Ito S., Suzuki N., Tomita Y. Am. J. Hum. Genet. 73:693-699(2003) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS DSH PRO-923 AND SER-1165. |
| [46] | "Seven novel mutations of the ADAR gene in Chinese families and sporadic patients with dyschromatosis symmetrica hereditaria (DSH)." Zhang X.-J., He P.-P., Li M., He C.-D., Yan K.-L., Cui Y., Yang S., Zhang K.-Y., Gao M., Chen J.-J., Li C.-R., Jin L., Chen H.-D., Xu S.-J., Huang W. Hum. Mutat. 23:629-630(2004) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT DSH PHE-966. |
| [47] | "A new arginine substitution mutation of DSRAD gene in a Chinese family with dyschromatosis symmetrica hereditaria." Li C.-R., Li M., Ma H.-J., Luo D., Yang L.-J., Wang D.-G., Zhu X.-H., Yue X.-Z., Chen W.-Q., Zhu W.-Y. J. Dermatol. Sci. 37:95-99(2005) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT DSH TRP-1155. |
| [48] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] VAL-806. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U10439 mRNA. Translation: AAB06697.1. U75503 U75502 Genomic DNA. Translation: AAB97116.1.U75503 U75502 Genomic DNA. Translation: AAB97117.1.U75503 U75502 Genomic DNA. Translation: AAB97118.1.U18121 mRNA. Translation: AAC13782.1. X79448 mRNA. Translation: CAA55967.1. X79449 mRNA. Translation: CAA55968.1. X98559 mRNA. Translation: CAA67169.1. X98559 mRNA. Translation: CAA67170.1. BX538232 mRNA. Translation: CAD98075.1. BX640741 mRNA. Translation: CAE45853.1. Sequence problems. AL606500, AL592078, AL691488 Genomic DNA. Translation: CAH71907.1. AL606500, AL592078, AL691488 Genomic DNA. Translation: CAH71908.1. AL592078, AL606500, AL691488 Genomic DNA. Translation: CAI16183.1. AL592078, AL606500, AL691488 Genomic DNA. Translation: CAI16185.1. AL691488, AL592078, AL606500 Genomic DNA. Translation: CAI17375.1. AL691488, AL592078, AL606500 Genomic DNA. Translation: CAI17376.1. CH471121 Genomic DNA. Translation: EAW53183.1. CH471121 Genomic DNA. Translation: EAW53187.1. BC038227 mRNA. Translation: AAH38227.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00025057. IPI00025058. IPI00394665. IPI00394668. IPI00760588. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | S65593. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001020278.1. NM_001025107.2. NP_001102.2. NM_001111.4. NP_001180424.1. NM_001193495.1. NP_056655.2. NM_015840.3. NP_056656.2. NM_015841.3. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.12341. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | P55265. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMR | P55265. Positions 134-199, 294-366, 511-575, 731-797. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DIP | DIP-29310N. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | P55265. 8 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MINT | MINT-4531596. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000357459. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | P55265. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PaxDb | P55265. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | P55265. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DNASU | 103. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000368471; ENSP00000357456; ENSG00000160710. ENST00000368474; ENSP00000357459; ENSG00000160710. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 103. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:103. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc001ffh.3. human. uc001ffi.3. human. uc001ffj.3. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 103. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC01M154554. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:225. ADAR. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB056157. HPA003890. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 127400. phenotype. 146920. gene. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_P55265. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Orphanet | 51. Aicardi-Goutieres syndrome. 41. Dyschromatosis symmetrica hereditaria. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA24555. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | NOG292433. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG067087. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KO | K12968. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG4HDSSW. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_1675. mRNA Processing. REACT_6900. Immune System. REACT_71. Gene Expression. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | P55265. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | P55265. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_ADAR. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | P55265. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000160710. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene3D | 1.10.10.10. 2 hits. 3.30.160.20. 3 hits. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR002466. A_deamin. IPR001159. Ds-RNA-bd. IPR014720. dsRNA-bd-like_dom. IPR000607. dsRNA_A_deaminase. IPR011991. WHTH_DNA-bd_dom. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF02137. A_deamin. 1 hit. PF00035. dsrm. 3 hits. PF02295. z-alpha. 2 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00552. ADEAMc. 1 hit. SM00358. DSRM. 3 hits. SM00550. Zalpha. 2 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS50141. A_DEAMIN_EDITASE. 1 hit. PS50139. DRADA_REPEAT. 2 hits. PS50137. DS_RBD. 3 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ChiTaRS | ADAR. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | P55265. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 103. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 389. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PMAP-CutDB | P55265. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | DSRAD_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P55265 Secondary accession number(s): B1AQQ9 Q9BYM4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
