Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Double-stranded RNA-specific adenosine deaminase

Gene

ADAR

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Catalyzes the hydrolytic deamination of adenosine to inosine in double-stranded RNA (dsRNA) referred to as A-to-I RNA editing. This may affect gene expression and function in a number of ways that include mRNA translation by changing codons and hence the amino acid sequence of proteins; pre-mRNA splicing by altering splice site recognition sequences; RNA stability by changing sequences involved in nuclease recognition; genetic stability in the case of RNA virus genomes by changing sequences during viral RNA replication; and RNA structure-dependent activities such as microRNA production or targeting or protein-RNA interactions. Can edit both viral and cellular RNAs and can edit RNAs at multiple sites (hyper-editing) or at specific sites (site-specific editing). Its cellular RNA substrates include: bladder cancer-associated protein (BLCAP), neurotransmitter receptors for glutamate (GRIA2) and serotonin (HTR2C) and GABA receptor (GABRA3). Site-specific RNA editing of transcripts encoding these proteins results in amino acid substitutions which consequently alters their functional activities. Exhibits low-level editing at the GRIA2 Q/R site, but edits efficiently at the R/G site and HOTSPOT1. Its viral RNA substrates include: hepatitis C virus (HCV), vesicular stomatitis virus (VSV), measles virus (MV), hepatitis delta virus (HDV), and human immunodeficiency virus type 1 (HIV-1). Exhibits either a proviral (HDV, MV, VSV and HIV-1) or an antiviral effect (HCV) and this can be editing-dependent (HDV and HCV), editing-independent (VSV and MV) or both (HIV-1). Impairs HCV replication via RNA editing at multiple sites. Enhances the replication of MV, VSV and HIV-1 through an editing-independent mechanism via suppression of EIF2AK2/PKR activation and function. Stimulates both the release and infectivity of HIV-1 viral particles by an editing-dependent mechanism where it associates with viral RNAs and edits adenosines in the 5'UTR and the Rev and Tat coding sequence. Can enhance viral replication of HDV via A-to-I editing at a site designated as amber/W, thereby changing an UAG amber stop codon to an UIG tryptophan (W) codon that permits synthesis of the large delta antigen (L-HDAg) which has a key role in the assembly of viral particles. However, high levels of ADAR1 inhibit HDV replication.10 Publications

Catalytic activityi

Adenine in double-stranded RNA + H2O = hypoxanthine in double-stranded RNA + NH3.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi910ZincPROSITE-ProRule annotation1
Active sitei912Proton donorPROSITE-ProRule annotation1
Metal bindingi966ZincPROSITE-ProRule annotation1
Metal bindingi1036ZincPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi169 – 195Add BLAST27

GO - Molecular functioni

  • DNA binding Source: UniProtKB-KW
  • double-stranded RNA adenosine deaminase activity Source: UniProtKB
  • metal ion binding Source: UniProtKB-KW
  • poly(A) RNA binding Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Biological processi

Antiviral defense, Immunity, Innate immunity, mRNA processing, RNA-mediated gene silencing

Keywords - Ligandi

DNA-binding, Metal-binding, RNA-binding, Zinc

Enzyme and pathway databases

BioCyciZFISH:ENSG00000160710-MONOMER.
BRENDAi3.5.4.37. 2681.
ReactomeiR-HSA-75102. C6 deamination of adenosine.
R-HSA-77042. Formation of editosomes by ADAR proteins.
R-HSA-909733. Interferon alpha/beta signaling.

Names & Taxonomyi

Protein namesi
Recommended name:
Double-stranded RNA-specific adenosine deaminase (EC:3.5.4.37)
Short name:
DRADA
Alternative name(s):
136 kDa double-stranded RNA-binding protein
Short name:
p136
Interferon-inducible protein 4
Short name:
IFI-4
K88DSRBP
Gene namesi
Name:ADAR
Synonyms:ADAR1, DSRAD, G1P1, IFI4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:225. ADAR.

Subcellular locationi

Isoform 1 :
Isoform 5 :
  • Cytoplasm
  • Nucleus
  • Nucleusnucleolus

  • Note: Predominantly nuclear but can shuttle between nucleus and cytoplasm. TNPO1 can mediate its nuclear import whereas XPO1 can mediate its nuclear export.

GO - Cellular componenti

  • cytoplasm Source: UniProtKB
  • membrane Source: UniProtKB
  • nucleolus Source: HPA
  • nucleoplasm Source: HPA
  • nucleus Source: UniProtKB
  • supraspliceosomal complex Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Involvement in diseasei

Dyschromatosis symmetrica hereditaria (DSH)3 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal dominant pigmentary genodermatosis characterized by a mixture of hyperpigmented and hypopigmented macules distributed on the face and the dorsal parts of the hands and feet, that appear in infancy or early childhood.
See also OMIM:127400
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_017604923L → P in DSH. 1 PublicationCorresponds to variant rs28936680dbSNPEnsembl.1
Natural variantiVAR_021729966C → F in DSH. 1 Publication1
Natural variantiVAR_0266691155R → W in DSH. 1 Publication1
Natural variantiVAR_0176051165F → S in DSH. 1 PublicationCorresponds to variant rs28936681dbSNPEnsembl.1
Aicardi-Goutieres syndrome 6 (AGS6)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of Aicardi-Goutieres syndrome, a genetically heterogeneous disease characterized by cerebral atrophy, leukoencephalopathy, intracranial calcifications, chronic cerebrospinal fluid (CSF) lymphocytosis, increased CSF alpha-interferon, and negative serologic investigations for common prenatal infection. Clinical features as thrombocytopenia, hepatosplenomegaly and elevated hepatic transaminases along with intermittent fever may erroneously suggest an infective process. Severe neurological dysfunctions manifest in infancy as progressive microcephaly, spasticity, dystonic posturing and profound psychomotor retardation. Death often occurs in early childhood.
See also OMIM:615010
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_069535193P → A in AGS6. 1 PublicationCorresponds to variant rs145588689dbSNPEnsembl.1
Natural variantiVAR_069536870A → T in AGS6. 1 PublicationCorresponds to variant rs398122893dbSNPEnsembl.1
Natural variantiVAR_069537872I → T in AGS6. 1 PublicationCorresponds to variant rs398122897dbSNPEnsembl.1
Natural variantiVAR_069538892R → H in AGS6. 1 PublicationCorresponds to variant rs398122892dbSNPEnsembl.1
Natural variantiVAR_069539999K → N in AGS6. 1 PublicationCorresponds to variant rs398122896dbSNPEnsembl.1
Natural variantiVAR_0695401007G → R in AGS6. 1 PublicationCorresponds to variant rs398122822dbSNPEnsembl.1
Natural variantiVAR_0695411112Y → F in AGS6. 1 PublicationCorresponds to variant rs398122895dbSNPEnsembl.1
Natural variantiVAR_0695421113D → H in AGS6. 1 PublicationCorresponds to variant rs398122894dbSNPEnsembl.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi418K → R: Abolishes sumoylation. 1 Publication1

Keywords - Diseasei

Aicardi-Goutieres syndrome, Disease mutation

Organism-specific databases

DisGeNETi103.
MalaCardsiADAR.
MIMi127400. phenotype.
615010. phenotype.
OpenTargetsiENSG00000160710.
Orphaneti51. Aicardi-Goutieres syndrome.
41. Dyschromatosis symmetrica hereditaria.
225154. Familial infantile bilateral striatal necrosis.
PharmGKBiPA24555.

Polymorphism and mutation databases

BioMutaiADAR.
DMDMi313104303.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001717741 – 1226Double-stranded RNA-specific adenosine deaminaseAdd BLAST1226

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei26Asymmetric dimethylarginineCombined sources1
Modified residuei285PhosphoserineBy similarity1
Cross-linki418Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO); alternate
Cross-linki418Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1); alternateCombined sources
Cross-linki418Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateCombined sources
Modified residuei481PhosphoserineCombined sources1
Modified residuei601PhosphothreonineCombined sources1
Modified residuei603PhosphothreonineCombined sources1
Modified residuei614PhosphoserineCombined sources1
Modified residuei629PhosphoserineCombined sources1
Modified residuei636PhosphoserineCombined sources1
Modified residuei808PhosphothreonineCombined sources1
Modified residuei814PhosphoserineCombined sources1
Modified residuei823PhosphoserineCombined sources1
Modified residuei825PhosphoserineCombined sources1

Post-translational modificationi

Sumoylation reduces RNA-editing activity.1 Publication

Keywords - PTMi

Isopeptide bond, Methylation, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiP55265.
MaxQBiP55265.
PaxDbiP55265.
PeptideAtlasiP55265.
PRIDEiP55265.

PTM databases

iPTMnetiP55265.
PhosphoSitePlusiP55265.
SwissPalmiP55265.

Miscellaneous databases

PMAP-CutDBP55265.

Expressioni

Tissue specificityi

Ubiquitously expressed, highest levels were found in brain and lung. Isoform 5 is expressed at higher levels in astrocytomas as compared to normal brain tissue and expression increases strikingly with the severity of the tumor, being higher in the most aggressive tumors.1 Publication

Inductioni

Isoform 1 is induced by interferon alpha. Isoform 5 is constitutively expressed.1 Publication

Gene expression databases

BgeeiENSG00000160710.
CleanExiHS_ADAR.
ExpressionAtlasiP55265. baseline and differential.
GenevisibleiP55265. HS.

Organism-specific databases

HPAiCAB056157.
HPA003890.
HPA051519.

Interactioni

Subunit structurei

Homodimer. Homodimerization is essential for its catalytic activity. Isoform 5 can form heterodimers with ADARB1/ADAR2. Isoform 1 interacts with ILF2/NF45 and ILF3/NF90. Binding to ILF3/NF90 up-regulates ILF3-mediated gene expression. Isoform 5 (via DRBM 3 domain) interacts with TNPO1. Isoform 5 (via DRBM domains) interacts with XPO5. Isoform 1 and isoform 5 can interact with EIF2AK2/PKR and UPF1.8 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
P143402EBI-2462104,EBI-9825968From a different organism.
Q99IB83EBI-2462104,EBI-6858501From a different organism.
DICER1Q9UPY38EBI-6913210,EBI-395506
NSP034968EBI-2462104,EBI-2547442From a different organism.
TARBP2Q156333EBI-6913210,EBI-978581

Protein-protein interaction databases

BioGridi106617. 68 interactors.
DIPiDIP-29310N.
IntActiP55265. 51 interactors.
MINTiMINT-4531596.
STRINGi9606.ENSP00000357459.

Structurei

Secondary structure

11226
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi127 – 130Combined sources4
Helixi135 – 150Combined sources16
Beta strandi152 – 154Combined sources3
Helixi158 – 165Combined sources8
Helixi169 – 181Combined sources13
Beta strandi184 – 192Combined sources9
Beta strandi194 – 197Combined sources4
Helixi294 – 309Combined sources16
Helixi315 – 322Combined sources8
Helixi324 – 326Combined sources3
Helixi327 – 339Combined sources13
Beta strandi342 – 346Combined sources5
Beta strandi348 – 350Combined sources3
Beta strandi352 – 355Combined sources4
Helixi357 – 360Combined sources4
Turni361 – 363Combined sources3
Helixi716 – 724Combined sources9
Helixi727 – 738Combined sources12
Beta strandi742 – 749Combined sources8
Beta strandi758 – 764Combined sources7
Beta strandi767 – 776Combined sources10
Helixi777 – 796Combined sources20

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1QBJX-ray2.10A/B/C133-209[»]
1QGPNMR-A125-200[»]
1XMKX-ray0.97A294-366[»]
2ACJX-ray2.60A/B/C/D140-202[»]
2GXBX-ray2.25A/B140-202[»]
2L54NMR-A136-198[»]
2MDRNMR-A708-801[»]
3F21X-ray2.20A/B/C133-209[»]
3F22X-ray2.50A/B/C133-209[»]
3F23X-ray2.70A/B/C133-209[»]
3IRQX-ray2.80A/B/C/D140-202[»]
3IRRX-ray2.65A/B/C/D140-202[»]
ProteinModelPortaliP55265.
SMRiP55265.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP55265.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati133 – 202DRADA 1Add BLAST70
Repeati293 – 360DRADA 2Add BLAST68
Domaini503 – 571DRBM 1PROSITE-ProRule annotationAdd BLAST69
Domaini614 – 682DRBM 2PROSITE-ProRule annotationAdd BLAST69
Domaini726 – 794DRBM 3PROSITE-ProRule annotationAdd BLAST69
Domaini886 – 1221A to I editasePROSITE-ProRule annotationAdd BLAST336

Sequence similaritiesi

Contains 1 A to I editase domain.PROSITE-ProRule annotation
Contains 2 DRADA repeats.PROSITE-ProRule annotation
Contains 3 DRBM (double-stranded RNA-binding) domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG2777. Eukaryota.
ENOG410XT0Z. LUCA.
GeneTreeiENSGT00550000074412.
HOVERGENiHBG067087.
InParanoidiP55265.
KOiK12968.
OMAiDPKFQYC.
OrthoDBiEOG091G0MZP.
PhylomeDBiP55265.
TreeFamiTF315806.

Family and domain databases

Gene3Di1.10.10.10. 2 hits.
3.30.160.20. 3 hits.
InterProiIPR002466. A_deamin.
IPR014720. dsRBD_dom.
IPR000607. dsRNA_A_deaminase.
IPR011991. WHTH_DNA-bd_dom.
[Graphical view]
PfamiPF02137. A_deamin. 1 hit.
PF00035. dsrm. 3 hits.
PF02295. z-alpha. 2 hits.
[Graphical view]
SMARTiSM00552. ADEAMc. 1 hit.
SM00358. DSRM. 3 hits.
SM00550. Zalpha. 2 hits.
[Graphical view]
SUPFAMiSSF46785. SSF46785. 2 hits.
PROSITEiPS50141. A_DEAMIN_EDITASE. 1 hit.
PS50139. DRADA_REPEAT. 2 hits.
PS50137. DS_RBD. 3 hits.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P55265-1) [UniParc]FASTAAdd to basket
Also known as: ADAR-a, ADAR1L, p150

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNPRQGYSLS GYYTHPFQGY EHRQLRYQQP GPGSSPSSFL LKQIEFLKGQ
60 70 80 90 100
LPEAPVIGKQ TPSLPPSLPG LRPRFPVLLA SSTRGRQVDI RGVPRGVHLR
110 120 130 140 150
SQGLQRGFQH PSPRGRSLPQ RGVDCLSSHF QELSIYQDQE QRILKFLEEL
160 170 180 190 200
GEGKATTAHD LSGKLGTPKK EINRVLYSLA KKGKLQKEAG TPPLWKIAVS
210 220 230 240 250
TQAWNQHSGV VRPDGHSQGA PNSDPSLEPE DRNSTSVSED LLEPFIAVSA
260 270 280 290 300
QAWNQHSGVV RPDSHSQGSP NSDPGLEPED SNSTSALEDP LEFLDMAEIK
310 320 330 340 350
EKICDYLFNV SDSSALNLAK NIGLTKARDI NAVLIDMERQ GDVYRQGTTP
360 370 380 390 400
PIWHLTDKKR ERMQIKRNTN SVPETAPAAI PETKRNAEFL TCNIPTSNAS
410 420 430 440 450
NNMVTTEKVE NGQEPVIKLE NRQEARPEPA RLKPPVHYNG PSKAGYVDFE
460 470 480 490 500
NGQWATDDIP DDLNSIRAAP GEFRAIMEMP SFYSHGLPRC SPYKKLTECQ
510 520 530 540 550
LKNPISGLLE YAQFASQTCE FNMIEQSGPP HEPRFKFQVV INGREFPPAE
560 570 580 590 600
AGSKKVAKQD AAMKAMTILL EEAKAKDSGK SEESSHYSTE KESEKTAESQ
610 620 630 640 650
TPTPSATSFF SGKSPVTTLL ECMHKLGNSC EFRLLSKEGP AHEPKFQYCV
660 670 680 690 700
AVGAQTFPSV SAPSKKVAKQ MAAEEAMKAL HGEATNSMAS DNQPEGMISE
710 720 730 740 750
SLDNLESMMP NKVRKIGELV RYLNTNPVGG LLEYARSHGF AAEFKLVDQS
760 770 780 790 800
GPPHEPKFVY QAKVGGRWFP AVCAHSKKQG KQEAADAALR VLIGENEKAE
810 820 830 840 850
RMGFTEVTPV TGASLRRTML LLSRSPEAQP KTLPLTGSTF HDQIAMLSHR
860 870 880 890 900
CFNTLTNSFQ PSLLGRKILA AIIMKKDSED MGVVVSLGTG NRCVKGDSLS
910 920 930 940 950
LKGETVNDCH AEIISRRGFI RFLYSELMKY NSQTAKDSIF EPAKGGEKLQ
960 970 980 990 1000
IKKTVSFHLY ISTAPCGDGA LFDKSCSDRA MESTESRHYP VFENPKQGKL
1010 1020 1030 1040 1050
RTKVENGEGT IPVESSDIVP TWDGIRLGER LRTMSCSDKI LRWNVLGLQG
1060 1070 1080 1090 1100
ALLTHFLQPI YLKSVTLGYL FSQGHLTRAI CCRVTRDGSA FEDGLRHPFI
1110 1120 1130 1140 1150
VNHPKVGRVS IYDSKRQSGK TKETSVNWCL ADGYDLEILD GTRGTVDGPR
1160 1170 1180 1190 1200
NELSRVSKKN IFLLFKKLCS FRYRRDLLRL SYGEAKKAAR DYETAKNYFK
1210 1220
KGLKDMGYGN WISKPQEEKN FYLCPV
Note: Produced by alternative promoter usage.
Length:1,226
Mass (Da):136,066
Last modified:November 30, 2010 - v4
Checksum:i9CE095D6F9C1BC79
GO
Isoform 2 (identifier: P55265-2) [UniParc]FASTAAdd to basket
Also known as: ADAR-b

The sequence of this isoform differs from the canonical sequence as follows:
     807-832: Missing.

Note: Produced by alternative splicing of isoform 1.
Show »
Length:1,200
Mass (Da):133,274
Checksum:i4CB1B306DAC584FC
GO
Isoform 3 (identifier: P55265-3) [UniParc]FASTAAdd to basket
Also known as: ADAR-c

The sequence of this isoform differs from the canonical sequence as follows:
     694-712: Missing.
     807-832: Missing.

Note: Produced by alternative splicing of isoform 1.
Show »
Length:1,181
Mass (Da):131,170
Checksum:i9764C8AB27BE118E
GO
Isoform 4 (identifier: P55265-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-5: MNPRQ → MMSPICDQTIDSRLKVEKATWWGRVGGGSRPHWQPPGVRPCPEEVQDP

Note: Produced by alternative splicing of isoform 1. No experimental confirmation available. The N-terminus has been derived from EST and genomic sequences.Curated
Show »
Length:1,269
Mass (Da):140,838
Checksum:iBB9B1DF19B8D3BC8
GO
Isoform 5 (identifier: P55265-5) [UniParc]FASTAAdd to basket
Also known as: ADAR1S, p110

The sequence of this isoform differs from the canonical sequence as follows:
     1-295: Missing.

Note: Produced by alternative promoter usage.
Show »
Length:931
Mass (Da):103,642
Checksum:i113B63CF165097FC
GO

Sequence cautioni

The sequence CAE45853 differs from that shown. Reason: Erroneous termination at position 1227. Translated as stop.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti53E → G in CAA55968 (Ref. 4) Curated1
Sequence conflicti245F → L in CAE45853 (PubMed:17974005).Curated1
Sequence conflicti482F → L in CAE45853 (PubMed:17974005).Curated1
Sequence conflicti873I → V in CAE45853 (PubMed:17974005).Curated1
Sequence conflicti1093D → G in CAE45853 (PubMed:17974005).Curated1
Sequence conflicti1184E → K in CAA55967 (Ref. 4) Curated1
Sequence conflicti1184E → K in CAA55968 (Ref. 4) Curated1
Sequence conflicti1184E → K in CAA67169 (Ref. 4) Curated1
Sequence conflicti1184E → K in CAA67170 (Ref. 4) Curated1
Isoform 4 (identifier: P55265-4)
Sequence conflicti13R → G in CAE45853 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_048725100R → G.6 PublicationsCorresponds to variant rs1466731dbSNPEnsembl.1
Natural variantiVAR_069535193P → A in AGS6. 1 PublicationCorresponds to variant rs145588689dbSNPEnsembl.1
Natural variantiVAR_017240384K → R.4 PublicationsCorresponds to variant rs2229857dbSNPEnsembl.1
Natural variantiVAR_024407587Y → C.Corresponds to variant rs17843865dbSNPEnsembl.1
Natural variantiVAR_035805806E → V in a breast cancer sample; somatic mutation. 1 PublicationCorresponds to variant rs144119808dbSNPEnsembl.1
Natural variantiVAR_069536870A → T in AGS6. 1 PublicationCorresponds to variant rs398122893dbSNPEnsembl.1
Natural variantiVAR_069537872I → T in AGS6. 1 PublicationCorresponds to variant rs398122897dbSNPEnsembl.1
Natural variantiVAR_069538892R → H in AGS6. 1 PublicationCorresponds to variant rs398122892dbSNPEnsembl.1
Natural variantiVAR_017604923L → P in DSH. 1 PublicationCorresponds to variant rs28936680dbSNPEnsembl.1
Natural variantiVAR_021729966C → F in DSH. 1 Publication1
Natural variantiVAR_069539999K → N in AGS6. 1 PublicationCorresponds to variant rs398122896dbSNPEnsembl.1
Natural variantiVAR_0695401007G → R in AGS6. 1 PublicationCorresponds to variant rs398122822dbSNPEnsembl.1
Natural variantiVAR_0695411112Y → F in AGS6. 1 PublicationCorresponds to variant rs398122895dbSNPEnsembl.1
Natural variantiVAR_0695421113D → H in AGS6. 1 PublicationCorresponds to variant rs398122894dbSNPEnsembl.1
Natural variantiVAR_0266691155R → W in DSH. 1 Publication1
Natural variantiVAR_0176051165F → S in DSH. 1 PublicationCorresponds to variant rs28936681dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0192351 – 295Missing in isoform 5. 1 PublicationAdd BLAST295
Alternative sequenceiVSP_0088721 – 5MNPRQ → MMSPICDQTIDSRLKVEKAT WWGRVGGGSRPHWQPPGVRP CPEEVQDP in isoform 4. 1 Publication5
Alternative sequenceiVSP_008873694 – 712Missing in isoform 3. CuratedAdd BLAST19
Alternative sequenceiVSP_008874807 – 832Missing in isoform 2 and isoform 3. CuratedAdd BLAST26

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U10439 mRNA. Translation: AAB06697.1.
U75503
, U75489, U75490, U75491, U75492, U75493, U75494, U75495, U75496, U75497, U75498, U75499, U75500, U75501, U75502 Genomic DNA. Translation: AAB97116.1.
U75503
, U75489, U75490, U75491, U75492, U75493, U75494, U75495, U75496, U75497, U75498, U75499, U75500, U75501, U75502 Genomic DNA. Translation: AAB97117.1.
U75503
, U75489, U75490, U75491, U75492, U75493, U75494, U75495, U75496, U75497, U75498, U75499, U75500, U75501, U75502 Genomic DNA. Translation: AAB97118.1.
U18121 mRNA. Translation: AAC13782.1.
X79448 mRNA. Translation: CAA55967.1.
X79449 mRNA. Translation: CAA55968.1.
X98559 mRNA. Translation: CAA67169.1.
X98559 mRNA. Translation: CAA67170.1.
BX538232 mRNA. Translation: CAD98075.1.
BX640741 mRNA. Translation: CAE45853.1. Sequence problems.
AL606500, AL592078, AL691488 Genomic DNA. Translation: CAH71907.1.
AL606500, AL592078, AL691488 Genomic DNA. Translation: CAH71908.1.
AL592078, AL606500, AL691488 Genomic DNA. Translation: CAI16183.1.
AL592078, AL606500, AL691488 Genomic DNA. Translation: CAI16185.1.
AL691488, AL592078, AL606500 Genomic DNA. Translation: CAI17375.1.
AL691488, AL592078, AL606500 Genomic DNA. Translation: CAI17376.1.
CH471121 Genomic DNA. Translation: EAW53183.1.
CH471121 Genomic DNA. Translation: EAW53187.1.
BC038227 mRNA. Translation: AAH38227.1.
CCDSiCCDS1071.1. [P55265-1]
CCDS30879.1. [P55265-5]
PIRiS65593.
RefSeqiNP_001020278.1. NM_001025107.2. [P55265-5]
NP_001102.2. NM_001111.4.
NP_001180424.1. NM_001193495.1. [P55265-5]
NP_056655.2. NM_015840.3.
NP_056656.2. NM_015841.3.
XP_006711174.1. XM_006711111.3. [P55265-5]
XP_006711175.1. XM_006711112.2. [P55265-5]
XP_006711176.1. XM_006711113.2. [P55265-5]
UniGeneiHs.12341.

Genome annotation databases

EnsembliENST00000368471; ENSP00000357456; ENSG00000160710. [P55265-5]
ENST00000368474; ENSP00000357459; ENSG00000160710. [P55265-1]
GeneIDi103.
KEGGihsa:103.
UCSCiuc001ffh.4. human. [P55265-1]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U10439 mRNA. Translation: AAB06697.1.
U75503
, U75489, U75490, U75491, U75492, U75493, U75494, U75495, U75496, U75497, U75498, U75499, U75500, U75501, U75502 Genomic DNA. Translation: AAB97116.1.
U75503
, U75489, U75490, U75491, U75492, U75493, U75494, U75495, U75496, U75497, U75498, U75499, U75500, U75501, U75502 Genomic DNA. Translation: AAB97117.1.
U75503
, U75489, U75490, U75491, U75492, U75493, U75494, U75495, U75496, U75497, U75498, U75499, U75500, U75501, U75502 Genomic DNA. Translation: AAB97118.1.
U18121 mRNA. Translation: AAC13782.1.
X79448 mRNA. Translation: CAA55967.1.
X79449 mRNA. Translation: CAA55968.1.
X98559 mRNA. Translation: CAA67169.1.
X98559 mRNA. Translation: CAA67170.1.
BX538232 mRNA. Translation: CAD98075.1.
BX640741 mRNA. Translation: CAE45853.1. Sequence problems.
AL606500, AL592078, AL691488 Genomic DNA. Translation: CAH71907.1.
AL606500, AL592078, AL691488 Genomic DNA. Translation: CAH71908.1.
AL592078, AL606500, AL691488 Genomic DNA. Translation: CAI16183.1.
AL592078, AL606500, AL691488 Genomic DNA. Translation: CAI16185.1.
AL691488, AL592078, AL606500 Genomic DNA. Translation: CAI17375.1.
AL691488, AL592078, AL606500 Genomic DNA. Translation: CAI17376.1.
CH471121 Genomic DNA. Translation: EAW53183.1.
CH471121 Genomic DNA. Translation: EAW53187.1.
BC038227 mRNA. Translation: AAH38227.1.
CCDSiCCDS1071.1. [P55265-1]
CCDS30879.1. [P55265-5]
PIRiS65593.
RefSeqiNP_001020278.1. NM_001025107.2. [P55265-5]
NP_001102.2. NM_001111.4.
NP_001180424.1. NM_001193495.1. [P55265-5]
NP_056655.2. NM_015840.3.
NP_056656.2. NM_015841.3.
XP_006711174.1. XM_006711111.3. [P55265-5]
XP_006711175.1. XM_006711112.2. [P55265-5]
XP_006711176.1. XM_006711113.2. [P55265-5]
UniGeneiHs.12341.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1QBJX-ray2.10A/B/C133-209[»]
1QGPNMR-A125-200[»]
1XMKX-ray0.97A294-366[»]
2ACJX-ray2.60A/B/C/D140-202[»]
2GXBX-ray2.25A/B140-202[»]
2L54NMR-A136-198[»]
2MDRNMR-A708-801[»]
3F21X-ray2.20A/B/C133-209[»]
3F22X-ray2.50A/B/C133-209[»]
3F23X-ray2.70A/B/C133-209[»]
3IRQX-ray2.80A/B/C/D140-202[»]
3IRRX-ray2.65A/B/C/D140-202[»]
ProteinModelPortaliP55265.
SMRiP55265.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi106617. 68 interactors.
DIPiDIP-29310N.
IntActiP55265. 51 interactors.
MINTiMINT-4531596.
STRINGi9606.ENSP00000357459.

PTM databases

iPTMnetiP55265.
PhosphoSitePlusiP55265.
SwissPalmiP55265.

Polymorphism and mutation databases

BioMutaiADAR.
DMDMi313104303.

Proteomic databases

EPDiP55265.
MaxQBiP55265.
PaxDbiP55265.
PeptideAtlasiP55265.
PRIDEiP55265.

Protocols and materials databases

DNASUi103.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000368471; ENSP00000357456; ENSG00000160710. [P55265-5]
ENST00000368474; ENSP00000357459; ENSG00000160710. [P55265-1]
GeneIDi103.
KEGGihsa:103.
UCSCiuc001ffh.4. human. [P55265-1]

Organism-specific databases

CTDi103.
DisGeNETi103.
GeneCardsiADAR.
HGNCiHGNC:225. ADAR.
HPAiCAB056157.
HPA003890.
HPA051519.
MalaCardsiADAR.
MIMi127400. phenotype.
146920. gene.
615010. phenotype.
neXtProtiNX_P55265.
OpenTargetsiENSG00000160710.
Orphaneti51. Aicardi-Goutieres syndrome.
41. Dyschromatosis symmetrica hereditaria.
225154. Familial infantile bilateral striatal necrosis.
PharmGKBiPA24555.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2777. Eukaryota.
ENOG410XT0Z. LUCA.
GeneTreeiENSGT00550000074412.
HOVERGENiHBG067087.
InParanoidiP55265.
KOiK12968.
OMAiDPKFQYC.
OrthoDBiEOG091G0MZP.
PhylomeDBiP55265.
TreeFamiTF315806.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000160710-MONOMER.
BRENDAi3.5.4.37. 2681.
ReactomeiR-HSA-75102. C6 deamination of adenosine.
R-HSA-77042. Formation of editosomes by ADAR proteins.
R-HSA-909733. Interferon alpha/beta signaling.

Miscellaneous databases

ChiTaRSiADAR. human.
EvolutionaryTraceiP55265.
GeneWikiiADAR.
GenomeRNAii103.
PMAP-CutDBP55265.
PROiP55265.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000160710.
CleanExiHS_ADAR.
ExpressionAtlasiP55265. baseline and differential.
GenevisibleiP55265. HS.

Family and domain databases

Gene3Di1.10.10.10. 2 hits.
3.30.160.20. 3 hits.
InterProiIPR002466. A_deamin.
IPR014720. dsRBD_dom.
IPR000607. dsRNA_A_deaminase.
IPR011991. WHTH_DNA-bd_dom.
[Graphical view]
PfamiPF02137. A_deamin. 1 hit.
PF00035. dsrm. 3 hits.
PF02295. z-alpha. 2 hits.
[Graphical view]
SMARTiSM00552. ADEAMc. 1 hit.
SM00358. DSRM. 3 hits.
SM00550. Zalpha. 2 hits.
[Graphical view]
SUPFAMiSSF46785. SSF46785. 2 hits.
PROSITEiPS50141. A_DEAMIN_EDITASE. 1 hit.
PS50139. DRADA_REPEAT. 2 hits.
PS50137. DS_RBD. 3 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiDSRAD_HUMAN
AccessioniPrimary (citable) accession number: P55265
Secondary accession number(s): B1AQQ9
, B1AQR0, D3DV76, O15223, O43859, O43860, Q9BYM3, Q9BYM4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: November 30, 2010
Last modified: November 2, 2016
This is version 184 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

The N-terminus of isoform 4 has been derived from EST and genomic sequences.Curated

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.