Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Caspase-7

Gene

CASP7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Involved in the activation cascade of caspases responsible for apoptosis execution. Cleaves and activates sterol regulatory element binding proteins (SREBPs). Proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-|-Gly-217' bond. Overexpression promotes programmed cell death.

Catalytic activityi

Strict requirement for an Asp residue at position P1 and has a preferred cleavage sequence of Asp-Glu-Val-Asp-|-.

Enzyme regulationi

Inhibited by isatin sulfonamides.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei144By similarity1
Active sitei1861

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protease, Thiol protease

Keywords - Biological processi

Apoptosis

Enzyme and pathway databases

BioCyciZFISH:HS09288-MONOMER.
BRENDAi3.4.22.60. 2681.
ReactomeiR-HSA-111459. Activation of caspases through apoptosome-mediated cleavage.
R-HSA-111463. SMAC binds to IAPs.
R-HSA-111464. SMAC-mediated dissociation of IAP:caspase complexes.
R-HSA-111465. Apoptotic cleavage of cellular proteins.
R-HSA-264870. Caspase-mediated cleavage of cytoskeletal proteins.
SIGNORiP55210.

Protein family/group databases

MEROPSiC14.004.

Names & Taxonomyi

Protein namesi
Recommended name:
Caspase-7 (EC:3.4.22.60)
Short name:
CASP-7
Alternative name(s):
Apoptotic protease Mch-3
CMH-1
ICE-like apoptotic protease 3
Short name:
ICE-LAP3
Cleaved into the following 2 chains:
Gene namesi
Name:CASP7
Synonyms:MCH3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

HGNCiHGNC:1508. CASP7.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: ProtInc
  • cytosol Source: UniProtKB
  • nucleoplasm Source: Reactome
  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi186C → A: No apoptotic activity. 1

Organism-specific databases

DisGeNETi840.
OpenTargetsiENSG00000165806.
PharmGKBiPA26091.

Chemistry databases

ChEMBLiCHEMBL3468.
GuidetoPHARMACOLOGYi1623.

Polymorphism and mutation databases

BioMutaiCASP7.
DMDMi1730092.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
PropeptideiPRO_00000046162 – 23Add BLAST22
ChainiPRO_000000461724 – 198Caspase-7 subunit p20Add BLAST175
PropeptideiPRO_0000004618199 – 2068
ChainiPRO_0000004619207 – 303Caspase-7 subunit p11Add BLAST97

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1
Modified residuei37PhosphoserineCombined sources1

Post-translational modificationi

Cleavages by granzyme B or caspase-10 generate the two active subunits. Propeptide domains can also be cleaved efficiently by caspase-3. Active heterodimers between the small subunit of caspase-7 and the large subunit of caspase-3, and vice versa, also occur.1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein, Zymogen

Proteomic databases

EPDiP55210.
MaxQBiP55210.
PaxDbiP55210.
PeptideAtlasiP55210.
PRIDEiP55210.

PTM databases

iPTMnetiP55210.
PhosphoSitePlusiP55210.

Miscellaneous databases

PMAP-CutDBP55210.

Expressioni

Tissue specificityi

Highly expressed in lung, skeletal muscle, liver, kidney, spleen and heart, and moderately in testis. No expression in the brain.

Gene expression databases

BgeeiENSG00000165806.
CleanExiHS_CASP7.
ExpressionAtlasiP55210. baseline and differential.
GenevisibleiP55210. HS.

Organism-specific databases

HPAiCAB025563.

Interactioni

Subunit structurei

Heterotetramer that consists of two anti-parallel arranged heterodimers, each one formed by a 20 kDa (p20) and a 11 kDa (p11) subunit. Interacts with BIRC6/bruce.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
BIRC2Q134902EBI-523958,EBI-514538
NIF3L1Q9GZT84EBI-523958,EBI-740897
PAK2Q131776EBI-523958,EBI-1045887
SATQ6ICU93EBI-523958,EBI-10178867
SMPD1P174056EBI-523958,EBI-7095800
XIAPP981702EBI-523958,EBI-517127

Protein-protein interaction databases

BioGridi107290. 47 interactors.
DIPiDIP-29973N.
IntActiP55210. 13 interactors.
MINTiMINT-147084.
STRINGi9606.ENSP00000358327.

Chemistry databases

BindingDBiP55210.

Structurei

Secondary structure

1303
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi56 – 58Combined sources3
Beta strandi64 – 66Combined sources3
Beta strandi68 – 74Combined sources7
Helixi80 – 82Combined sources3
Helixi90 – 104Combined sources15
Beta strandi106 – 113Combined sources8
Helixi116 – 127Combined sources12
Helixi131 – 133Combined sources3
Beta strandi137 – 143Combined sources7
Beta strandi149 – 152Combined sources4
Beta strandi155 – 158Combined sources4
Helixi159 – 163Combined sources5
Helixi164 – 166Combined sources3
Turni168 – 170Combined sources3
Helixi172 – 174Combined sources3
Beta strandi179 – 185Combined sources7
Beta strandi188 – 190Combined sources3
Turni209 – 211Combined sources3
Turni215 – 218Combined sources4
Beta strandi219 – 225Combined sources7
Beta strandi227 – 229Combined sources3
Beta strandi232 – 234Combined sources3
Turni235 – 237Combined sources3
Helixi240 – 252Combined sources13
Turni253 – 255Combined sources3
Helixi258 – 272Combined sources15
Turni276 – 278Combined sources3
Helixi280 – 282Combined sources3
Beta strandi290 – 293Combined sources4
Beta strandi296 – 298Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1F1JX-ray2.35A/B2-303[»]
1GQFX-ray2.90A/B47-303[»]
1I4OX-ray2.40A/B24-303[»]
1I51X-ray2.45A/C51-198[»]
B/D199-303[»]
1K86X-ray2.60A/B51-303[»]
1K88X-ray2.70A/B51-303[»]
1KMCX-ray2.90A/B1-303[»]
1MIAmodel-A57-193[»]
B211-303[»]
1SHJX-ray2.80A/B50-303[»]
1SHLX-ray3.00A/B57-303[»]
2QL5X-ray2.34A/C24-196[»]
B/D207-303[»]
2QL7X-ray2.40A/C24-196[»]
B/D207-303[»]
2QL9X-ray2.14A/C24-196[»]
B/D207-303[»]
2QLBX-ray2.25A/C24-196[»]
B/D207-303[»]
2QLFX-ray2.80A/C24-196[»]
B/D207-303[»]
2QLJX-ray2.60A/C24-196[»]
B/D207-303[»]
3EDRX-ray2.45A/C24-196[»]
B/D207-303[»]
3H1PX-ray2.61A/B50-303[»]
3IBCX-ray2.75A/C24-196[»]
B/D207-303[»]
3IBFX-ray2.50A/C24-196[»]
B/D207-303[»]
3R5KX-ray2.86A/B1-303[»]
4FDLX-ray2.80A/B2-303[»]
4FEAX-ray3.79A/B57-303[»]
4HQ0X-ray3.00A/B47-303[»]
4HQRX-ray3.00A/B47-303[»]
4JB8X-ray1.70A24-198[»]
B207-303[»]
4JJ8X-ray2.94A/B57-303[»]
4JR1X-ray2.15A/B57-303[»]
4JR2X-ray1.65A/B57-303[»]
4LSZX-ray2.26A/C24-198[»]
B/D207-303[»]
4ZVOX-ray2.85A/C1-198[»]
B/D199-303[»]
4ZVPX-ray2.50A/C1-198[»]
B/D199-303[»]
4ZVQX-ray2.50A/C1-198[»]
B/D199-303[»]
4ZVRX-ray2.30A/C1-198[»]
B/D199-303[»]
4ZVSX-ray2.50A/C1-198[»]
B/D199-303[»]
4ZVTX-ray2.85A/C1-198[»]
B/D199-303[»]
4ZVUX-ray2.60A/C1-198[»]
B/D199-303[»]
5IC6X-ray2.70A/C1-198[»]
B/D199-303[»]
ProteinModelPortaliP55210.
SMRiP55210.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP55210.

Family & Domainsi

Sequence similaritiesi

Belongs to the peptidase C14A family.Curated

Phylogenomic databases

eggNOGiKOG3573. Eukaryota.
ENOG410ZQIE. LUCA.
GeneTreeiENSGT00760000118912.
HOVERGENiHBG050802.
InParanoidiP55210.
KOiK04397.
PhylomeDBiP55210.
TreeFamiTF102023.

Family and domain databases

CDDicd00032. CASc. 1 hit.
Gene3Di3.40.50.1460. 1 hit.
InterProiIPR029030. Caspase-like_dom.
IPR033139. Caspase_cys_AS.
IPR016129. Caspase_his_AS.
IPR002138. Pept_C14_p10.
IPR001309. Pept_C14_p20.
IPR015917. Pept_C14A.
IPR017350. Pept_C14A_CASP1-typ.
[Graphical view]
PIRSFiPIRSF038001. Caspase_ICE. 1 hit.
PRINTSiPR00376. IL1BCENZYME.
SMARTiSM00115. CASc. 1 hit.
[Graphical view]
SUPFAMiSSF52129. SSF52129. 1 hit.
PROSITEiPS01122. CASPASE_CYS. 1 hit.
PS01121. CASPASE_HIS. 1 hit.
PS50207. CASPASE_P10. 1 hit.
PS50208. CASPASE_P20. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform Alpha (identifier: P55210-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MADDQGCIEE QGVEDSANED SVDAKPDRSS FVPSLFSKKK KNVTMRSIKT
60 70 80 90 100
TRDRVPTYQY NMNFEKLGKC IIINNKNFDK VTGMGVRNGT DKDAEALFKC
110 120 130 140 150
FRSLGFDVIV YNDCSCAKMQ DLLKKASEED HTNAACFACI LLSHGEENVI
160 170 180 190 200
YGKDGVTPIK DLTAHFRGDR CKTLLEKPKL FFIQACRGTE LDDGIQADSG
210 220 230 240 250
PINDTDANPR YKIPVEADFL FAYSTVPGYY SWRSPGRGSW FVQALCSILE
260 270 280 290 300
EHGKDLEIMQ ILTRVNDRVA RHFESQSDDP HFHEKKQIPC VVSMLTKELY

FSQ
Length:303
Mass (Da):34,277
Last modified:October 1, 1996 - v1
Checksum:iCD373EE54A232CA4
GO
Isoform Beta (identifier: P55210-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     149-303: VIYGKDGVTP...MLTKELYFSQ → MESCSVTQAG...TWKSCRSSPG

Note: Lacks enzymatic activity.
Show »
Length:253
Mass (Da):28,030
Checksum:i514964EF3F6229E1
GO
Isoform Alpha' (identifier: P55210-3) [UniParc]FASTAAdd to basket
Also known as: Beta

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MDCVGWPPGRKWHLEKNTSCGGSSGICASYVTQM

Note: What we call isoform Alpha' is also known as Beta.1 Publication
Show »
Length:336
Mass (Da):37,815
Checksum:i34EEFF8AF5C318A2
GO
Isoform 4 (identifier: P55210-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLF → MQRGLFSDGDT

Show »
Length:278
Mass (Da):31,614
Checksum:iFAF2707D22D9CDE3
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti194G → A in AAC50346 (PubMed:8576161).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0486174D → E.2 PublicationsCorresponds to variant rs11593766dbSNPEnsembl.1
Natural variantiVAR_048618255D → E.Corresponds to variant rs2227310dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0453251 – 36MADDQ…VPSLF → MQRGLFSDGDT in isoform 4. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_0008061M → MDCVGWPPGRKWHLEKNTSC GGSSGICASYVTQM in isoform Alpha'. 3 Publications1
Alternative sequenceiVSP_000807149 – 303VIYGK…LYFSQ → MESCSVTQAGVQRRDLGRLQ PPPPRLAEGPSLMMASRPTR GPSMTQMLILDTRSQWKLTS SSPIPRFQAITRGGAQEEAP GLCKPSAPSWRSTEKTWKSC RSSPG in isoform Beta. 1 PublicationAdd BLAST155

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U37448 mRNA. Translation: AAC50303.1.
U37449 mRNA. Translation: AAC50304.1.
U39613 mRNA. Translation: AAC50346.1.
U40281 mRNA. Translation: AAC50352.1.
U67319 mRNA. Translation: AAC51152.1.
U67320 mRNA. Translation: AAC51153.1.
U67206 mRNA. Translation: AAF21460.1.
BT006683 mRNA. Translation: AAP35329.1.
AB451281 mRNA. Translation: BAG70095.1.
AB451413 mRNA. Translation: BAG70227.1.
AK298964 mRNA. Translation: BAG61059.1.
AL592546, AL627395 Genomic DNA. Translation: CAI12638.1.
AL592546, AL627395 Genomic DNA. Translation: CAI12639.1.
AL627395, AL592546 Genomic DNA. Translation: CAI16004.1.
AL627395, AL592546 Genomic DNA. Translation: CAI16005.1.
CH471066 Genomic DNA. Translation: EAW49494.1.
CH471066 Genomic DNA. Translation: EAW49495.1.
CH471066 Genomic DNA. Translation: EAW49498.1.
CH471066 Genomic DNA. Translation: EAW49496.1.
CH471066 Genomic DNA. Translation: EAW49497.1.
BC015799 mRNA. Translation: AAH15799.1.
CCDSiCCDS58096.1. [P55210-4]
CCDS7580.1. [P55210-3]
CCDS7581.1. [P55210-1]
CCDS7582.1. [P55210-2]
RefSeqiNP_001218.1. NM_001227.4. [P55210-1]
NP_001253985.1. NM_001267056.1. [P55210-1]
NP_001253986.1. NM_001267057.1.
NP_001253987.1. NM_001267058.1. [P55210-4]
NP_001307840.1. NM_001320911.1.
NP_203124.1. NM_033338.5. [P55210-3]
NP_203125.1. NM_033339.4. [P55210-1]
NP_203126.1. NM_033340.3. [P55210-2]
UniGeneiHs.9216.

Genome annotation databases

EnsembliENST00000345633; ENSP00000298701; ENSG00000165806. [P55210-1]
ENST00000369315; ENSP00000358321; ENSG00000165806. [P55210-1]
ENST00000369318; ENSP00000358324; ENSG00000165806. [P55210-1]
ENST00000369331; ENSP00000358337; ENSG00000165806. [P55210-2]
ENST00000452490; ENSP00000398107; ENSG00000165806. [P55210-4]
ENST00000614447; ENSP00000478285; ENSG00000165806. [P55210-2]
ENST00000621345; ENSP00000480584; ENSG00000165806. [P55210-1]
ENST00000621607; ENSP00000478999; ENSG00000165806. [P55210-3]
GeneIDi840.
KEGGihsa:840.
UCSCiuc001lam.5. human. [P55210-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U37448 mRNA. Translation: AAC50303.1.
U37449 mRNA. Translation: AAC50304.1.
U39613 mRNA. Translation: AAC50346.1.
U40281 mRNA. Translation: AAC50352.1.
U67319 mRNA. Translation: AAC51152.1.
U67320 mRNA. Translation: AAC51153.1.
U67206 mRNA. Translation: AAF21460.1.
BT006683 mRNA. Translation: AAP35329.1.
AB451281 mRNA. Translation: BAG70095.1.
AB451413 mRNA. Translation: BAG70227.1.
AK298964 mRNA. Translation: BAG61059.1.
AL592546, AL627395 Genomic DNA. Translation: CAI12638.1.
AL592546, AL627395 Genomic DNA. Translation: CAI12639.1.
AL627395, AL592546 Genomic DNA. Translation: CAI16004.1.
AL627395, AL592546 Genomic DNA. Translation: CAI16005.1.
CH471066 Genomic DNA. Translation: EAW49494.1.
CH471066 Genomic DNA. Translation: EAW49495.1.
CH471066 Genomic DNA. Translation: EAW49498.1.
CH471066 Genomic DNA. Translation: EAW49496.1.
CH471066 Genomic DNA. Translation: EAW49497.1.
BC015799 mRNA. Translation: AAH15799.1.
CCDSiCCDS58096.1. [P55210-4]
CCDS7580.1. [P55210-3]
CCDS7581.1. [P55210-1]
CCDS7582.1. [P55210-2]
RefSeqiNP_001218.1. NM_001227.4. [P55210-1]
NP_001253985.1. NM_001267056.1. [P55210-1]
NP_001253986.1. NM_001267057.1.
NP_001253987.1. NM_001267058.1. [P55210-4]
NP_001307840.1. NM_001320911.1.
NP_203124.1. NM_033338.5. [P55210-3]
NP_203125.1. NM_033339.4. [P55210-1]
NP_203126.1. NM_033340.3. [P55210-2]
UniGeneiHs.9216.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1F1JX-ray2.35A/B2-303[»]
1GQFX-ray2.90A/B47-303[»]
1I4OX-ray2.40A/B24-303[»]
1I51X-ray2.45A/C51-198[»]
B/D199-303[»]
1K86X-ray2.60A/B51-303[»]
1K88X-ray2.70A/B51-303[»]
1KMCX-ray2.90A/B1-303[»]
1MIAmodel-A57-193[»]
B211-303[»]
1SHJX-ray2.80A/B50-303[»]
1SHLX-ray3.00A/B57-303[»]
2QL5X-ray2.34A/C24-196[»]
B/D207-303[»]
2QL7X-ray2.40A/C24-196[»]
B/D207-303[»]
2QL9X-ray2.14A/C24-196[»]
B/D207-303[»]
2QLBX-ray2.25A/C24-196[»]
B/D207-303[»]
2QLFX-ray2.80A/C24-196[»]
B/D207-303[»]
2QLJX-ray2.60A/C24-196[»]
B/D207-303[»]
3EDRX-ray2.45A/C24-196[»]
B/D207-303[»]
3H1PX-ray2.61A/B50-303[»]
3IBCX-ray2.75A/C24-196[»]
B/D207-303[»]
3IBFX-ray2.50A/C24-196[»]
B/D207-303[»]
3R5KX-ray2.86A/B1-303[»]
4FDLX-ray2.80A/B2-303[»]
4FEAX-ray3.79A/B57-303[»]
4HQ0X-ray3.00A/B47-303[»]
4HQRX-ray3.00A/B47-303[»]
4JB8X-ray1.70A24-198[»]
B207-303[»]
4JJ8X-ray2.94A/B57-303[»]
4JR1X-ray2.15A/B57-303[»]
4JR2X-ray1.65A/B57-303[»]
4LSZX-ray2.26A/C24-198[»]
B/D207-303[»]
4ZVOX-ray2.85A/C1-198[»]
B/D199-303[»]
4ZVPX-ray2.50A/C1-198[»]
B/D199-303[»]
4ZVQX-ray2.50A/C1-198[»]
B/D199-303[»]
4ZVRX-ray2.30A/C1-198[»]
B/D199-303[»]
4ZVSX-ray2.50A/C1-198[»]
B/D199-303[»]
4ZVTX-ray2.85A/C1-198[»]
B/D199-303[»]
4ZVUX-ray2.60A/C1-198[»]
B/D199-303[»]
5IC6X-ray2.70A/C1-198[»]
B/D199-303[»]
ProteinModelPortaliP55210.
SMRiP55210.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107290. 47 interactors.
DIPiDIP-29973N.
IntActiP55210. 13 interactors.
MINTiMINT-147084.
STRINGi9606.ENSP00000358327.

Chemistry databases

BindingDBiP55210.
ChEMBLiCHEMBL3468.
GuidetoPHARMACOLOGYi1623.

Protein family/group databases

MEROPSiC14.004.

PTM databases

iPTMnetiP55210.
PhosphoSitePlusiP55210.

Polymorphism and mutation databases

BioMutaiCASP7.
DMDMi1730092.

Proteomic databases

EPDiP55210.
MaxQBiP55210.
PaxDbiP55210.
PeptideAtlasiP55210.
PRIDEiP55210.

Protocols and materials databases

DNASUi840.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000345633; ENSP00000298701; ENSG00000165806. [P55210-1]
ENST00000369315; ENSP00000358321; ENSG00000165806. [P55210-1]
ENST00000369318; ENSP00000358324; ENSG00000165806. [P55210-1]
ENST00000369331; ENSP00000358337; ENSG00000165806. [P55210-2]
ENST00000452490; ENSP00000398107; ENSG00000165806. [P55210-4]
ENST00000614447; ENSP00000478285; ENSG00000165806. [P55210-2]
ENST00000621345; ENSP00000480584; ENSG00000165806. [P55210-1]
ENST00000621607; ENSP00000478999; ENSG00000165806. [P55210-3]
GeneIDi840.
KEGGihsa:840.
UCSCiuc001lam.5. human. [P55210-1]

Organism-specific databases

CTDi840.
DisGeNETi840.
GeneCardsiCASP7.
HGNCiHGNC:1508. CASP7.
HPAiCAB025563.
MIMi601761. gene.
neXtProtiNX_P55210.
OpenTargetsiENSG00000165806.
PharmGKBiPA26091.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3573. Eukaryota.
ENOG410ZQIE. LUCA.
GeneTreeiENSGT00760000118912.
HOVERGENiHBG050802.
InParanoidiP55210.
KOiK04397.
PhylomeDBiP55210.
TreeFamiTF102023.

Enzyme and pathway databases

BioCyciZFISH:HS09288-MONOMER.
BRENDAi3.4.22.60. 2681.
ReactomeiR-HSA-111459. Activation of caspases through apoptosome-mediated cleavage.
R-HSA-111463. SMAC binds to IAPs.
R-HSA-111464. SMAC-mediated dissociation of IAP:caspase complexes.
R-HSA-111465. Apoptotic cleavage of cellular proteins.
R-HSA-264870. Caspase-mediated cleavage of cytoskeletal proteins.
SIGNORiP55210.

Miscellaneous databases

ChiTaRSiCASP7. human.
EvolutionaryTraceiP55210.
GeneWikiiCaspase_7.
GenomeRNAii840.
PMAP-CutDBP55210.
PROiP55210.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000165806.
CleanExiHS_CASP7.
ExpressionAtlasiP55210. baseline and differential.
GenevisibleiP55210. HS.

Family and domain databases

CDDicd00032. CASc. 1 hit.
Gene3Di3.40.50.1460. 1 hit.
InterProiIPR029030. Caspase-like_dom.
IPR033139. Caspase_cys_AS.
IPR016129. Caspase_his_AS.
IPR002138. Pept_C14_p10.
IPR001309. Pept_C14_p20.
IPR015917. Pept_C14A.
IPR017350. Pept_C14A_CASP1-typ.
[Graphical view]
PIRSFiPIRSF038001. Caspase_ICE. 1 hit.
PRINTSiPR00376. IL1BCENZYME.
SMARTiSM00115. CASc. 1 hit.
[Graphical view]
SUPFAMiSSF52129. SSF52129. 1 hit.
PROSITEiPS01122. CASPASE_CYS. 1 hit.
PS01121. CASPASE_HIS. 1 hit.
PS50207. CASPASE_P10. 1 hit.
PS50208. CASPASE_P20. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCASP7_HUMAN
AccessioniPrimary (citable) accession number: P55210
Secondary accession number(s): B4DQU7
, B5BU45, D3DRB8, Q13364, Q53YD5, Q5SVL0, Q5SVL3, Q96BA0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: October 1, 1996
Last modified: November 30, 2016
This is version 181 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Peptidase families
    Classification of peptidase families and list of entries
  7. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.