P55088 (AQP4_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 108.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Aquaporin-4 Short name=AQP-4 Alternative name(s): Mercurial-insensitive water channel Short name=MIWC WCH4 | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 323 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Forms a water-specific channel. Osmoreceptor which regulates body water balance and mediates water flow within the central nervous system. |
| Subunit structure | Homotetramer By similarity. Part of a complex containing MLC1, TRPV4, HEPACAM and ATP1B1 By similarity. |
| Subcellular location | |
| Domain | Aquaporins contain two tandem repeats each containing three membrane-spanning domains and a pore-forming loop with the signature motif Asn-Pro-Ala (NPA). |
| Post-translational modification | Phosphorylation by PKC at Ser-180 reduces conductance by 50%. Phosphorylation by PKG at Ser-111 in response to glutamats increases conductance by 40% By similarity. |
| Sequence similarities | Belongs to the MIP/aquaporin (TC 1.A.8) family. [View classification] |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 2 (identifier: P55088-1) Also known as: MIWC2; AQP4-M1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1 (identifier: P55088-2) Also known as: MIWC1; AQP4-M21; The sequence of this isoform differs from the canonical sequence as follows: 1-22: Missing. | ||||||
| Isoform 3 (identifier: P55088-3) Also known as: MIWC3; The sequence of this isoform differs from the canonical sequence as follows: 1-11: MSDGAAARRWG → MVHGFGCFVFFFLISLSSLWASEDSTCNSTLPLCHLATTLDCC |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 323 | 323 | Aquaporin-4 | PRO_0000063949 | |||||
Regions | |||||||||
| Topological domain | 1 – 36 | 36 | Cytoplasmic Potential | ||||||
| Transmembrane | 37 – 58 | 22 | Helical; Potential | ||||||
| Topological domain | 59 – 64 | 6 | Extracellular Potential | ||||||
| Transmembrane | 65 – 85 | 21 | Helical; Potential | ||||||
| Topological domain | 86 – 115 | 30 | Cytoplasmic Potential | ||||||
| Transmembrane | 116 – 136 | 21 | Helical; Potential | ||||||
| Topological domain | 137 – 155 | 19 | Extracellular Potential | ||||||
| Transmembrane | 156 – 176 | 21 | Helical; Potential | ||||||
| Topological domain | 177 – 184 | 8 | Cytoplasmic Potential | ||||||
| Transmembrane | 185 – 205 | 21 | Helical; Potential | ||||||
| Topological domain | 206 – 231 | 26 | Extracellular Potential | ||||||
| Transmembrane | 232 – 252 | 21 | Helical; Potential | ||||||
| Topological domain | 253 – 323 | 71 | Cytoplasmic Potential | ||||||
| Motif | 97 – 99 | 3 | NPA 1 | ||||||
| Motif | 213 – 215 | 3 | NPA 2 | ||||||
Amino acid modifications | |||||||||
| Modified residue | 111 | 1 | Phosphoserine; by PKG By similarity | ||||||
| Modified residue | 180 | 1 | Phosphoserine; by PKC By similarity | ||||||
| Modified residue | 285 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 321 | 1 | Phosphoserine By similarity | ||||||
| Glycosylation | 153 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 206 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 22 | 22 | Missing in isoform 1. | VSP_003233 | |||||
| Alternative sequence | 1 – 11 | 11 | MSDGAAARRWG → MVHGFGCFVFFFLISLSSLW ASEDSTCNSTLPLCHLATTL DCC in isoform 3. | VSP_003234 | |||||
| Natural variant | 4 | 1 | G → R. Ref.3 | ||||||
Experimental info | |||||||||
| Sequence conflict | 37 | 1 | A → S in AAB41571. Ref.1 | ||||||
| Sequence conflict | 51 | 1 | Missing in AAB41569. Ref.1 | ||||||
| Sequence conflict | 51 | 1 | Missing in AAB41570. Ref.1 | ||||||
| Sequence conflict | 88 | 1 | F → L in AAB41569. Ref.1 | ||||||
| Sequence conflict | 88 | 1 | F → L in AAB41570. Ref.1 | ||||||
| Sequence conflict | 174 | 1 | I → V in AAB41569. Ref.1 | ||||||
| Sequence conflict | 174 | 1 | I → V in AAB41570. Ref.1 | ||||||
| Sequence conflict | 313 | 1 | K → R in AAB41569. Ref.1 | ||||||
| Sequence conflict | 313 | 1 | K → R in AAB41570. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Gene structure, cDNA cloning, and expression of a mouse mercurial-insensitive water channel." Ma T., Yang B., Verkman A.S. Genomics 33:382-388(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3). Strain: C57BL/6. Tissue: Brain. |
| [2] | "Cloning and chromosomal localization of mouse aquaporin 4: exclusion of a candidate mutant phenotype, ataxia." Turtzo L.C., Lee M.D., Lu M., Smith B.L., Copeland N.G., Gilbert D.J., Jenkins N.A., Agre P. Genomics 41:267-270(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Strain: C57BL/6J. Tissue: Cerebellum. |
| [3] | "Identification of a new form of AQP4 mRNA that is developmentally expressed in mouse brain." Zelenin S., Gunnarson E., Alikina T., Bondar A., Aperia A. Pediatr. Res. 48:335-339(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), VARIANT ARG-4. |
| [4] | "Cloning of mouse full open reading frames in Gateway(R) system entry vector (pDONR201)." Ebert L., Muenstermann E., Schatten R., Henze S., Bohn E., Mollenhauer J., Wiemann S., Schick M., Korn B. Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Colon. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U48398 mRNA. Translation: AAB41569.1. U48397 mRNA. Translation: AAB41568.1. U33012 mRNA. Translation: AAA84923.1. U48400 Genomic DNA. Translation: AAB41571.1. U48399 mRNA. Translation: AAB41570.1. U88623 mRNA. Translation: AAC53155.1. AF469168 mRNA. Translation: AAL73545.1. AF469169 mRNA. Translation: AAL73546.1. AF219992 Genomic DNA. Translation: AAG44243.2. CT010362 mRNA. Translation: CAJ18569.1. BC024526 mRNA. Translation: AAH24526.1. |
| IPI | IPI00135626. IPI00230737. IPI00230738. |
| RefSeq | NP_033830.2. NM_009700.2. |
| UniGene | Mm.250786. |
3D structure databases | |
| ProteinModelPortal | P55088. |
| SMR | P55088. Positions 31-295. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P55088. 1 interaction. |
| MINT | MINT-4088102. |
PTM databases | |
| PhosphoSite | P55088. |
Proteomic databases | |
| PaxDb | P55088. |
| PRIDE | P55088. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000079081; ENSMUSP00000078088; ENSMUSG00000024411. |
| GeneID | 11829. |
| KEGG | mmu:11829. |
| UCSC | uc008edq.2. mouse. uc008eds.2. mouse. |
Organism-specific databases | |
| CTD | 361. |
| MGI | MGI:107387. Aqp4. |
Phylogenomic databases | |
| eggNOG | COG0580. |
| GeneTree | ENSGT00550000074347. |
| HOVERGEN | HBG000312. |
| KO | K09866. |
| OrthoDB | EOG46Q6T5. |
Gene expression databases | |
| ArrayExpress | P55088. |
| Bgee | P55088. |
| CleanEx | MM_AQP4. |
| Genevestigator | P55088. |
| GermOnline | ENSMUSG00000024411. Mus musculus. |
Family and domain databases | |
| Gene3D | 1.20.1080.10. 1 hit. |
| InterPro | IPR023271. Aquaporin-like. IPR000425. MIP. IPR022357. MIP_CS. [Graphical view] |
| PANTHER | PTHR19139. PTHR19139. 1 hit. |
| Pfam | PF00230. MIP. 1 hit. [Graphical view] |
| PRINTS | PR00783. MINTRINSICP. |
| SUPFAM | SSF81338. MIP. 1 hit. |
| TIGRFAMs | TIGR00861. MIP. 1 hit. |
| PROSITE | PS00221. MIP. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChEMBL | CHEMBL5965. |
| ChiTaRS | AQP4. mouse. |
| NextBio | 279739. |
| SOURCE | Search... |
Entry information
| Entry name | AQP4_MOUSE | ||||||||
| Accession | Primary (citable) accession number: P55088 Secondary accession number(s): P97818 Q9EQI3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
