Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P55088 (AQP4_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 118. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Aquaporin-4

Short name=AQP-4
Alternative name(s):
Mercurial-insensitive water channel
Short name=MIWC
WCH4
Gene names
Name:Aqp4
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length323 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Forms a water-specific channel. Osmoreceptor which regulates body water balance and mediates water flow within the central nervous system.

Subunit structure

Homotetramer By similarity. Part of a complex containing MLC1, TRPV4, HEPACAM and ATP1B1 By similarity.

Subcellular location

Membrane; Multi-pass membrane protein.

Domain

Aquaporins contain two tandem repeats each containing three membrane-spanning domains and a pore-forming loop with the signature motif Asn-Pro-Ala (NPA).

Post-translational modification

Phosphorylation by PKC at Ser-180 reduces conductance by 50%. Phosphorylation by PKG at Ser-111 in response to glutamats increases conductance by 40% By similarity.

Sequence similarities

Belongs to the MIP/aquaporin (TC 1.A.8) family. [View classification]

Ontologies

Keywords
   Biological processTransport
   Cellular componentMembrane
   Coding sequence diversityAlternative splicing
   DomainRepeat
Transmembrane
Transmembrane helix
   PTMGlycoprotein
Phosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processcarbon dioxide transport

Inferred from electronic annotation. Source: Ensembl

cellular response to estradiol stimulus

Inferred from electronic annotation. Source: Ensembl

cellular response to interferon-gamma

Inferred from electronic annotation. Source: Ensembl

female pregnancy

Inferred from electronic annotation. Source: Ensembl

hyperosmotic salinity response

Inferred from electronic annotation. Source: Ensembl

protein homooligomerization

Inferred from electronic annotation. Source: Ensembl

renal water absorption

Inferred from mutant phenotype PubMed 10662735PubMed 10795927. Source: MGI

response to glucocorticoid

Inferred from electronic annotation. Source: Ensembl

response to radiation

Inferred from electronic annotation. Source: Ensembl

sensory perception of sound

Inferred from mutant phenotype PubMed 11406631. Source: MGI

water homeostasis

Non-traceable author statement Ref.1. Source: UniProtKB

water transport

Inferred from mutant phenotype PubMed 10613915. Source: MGI

   Cellular_componentT-tubule

Inferred from electronic annotation. Source: Ensembl

basolateral plasma membrane

Inferred from direct assay PubMed 10021464PubMed 10662735PubMed 21178974PubMed 21705333. Source: MGI

cell-cell junction

Inferred from direct assay PubMed 18718702. Source: UniProtKB

cytoplasm

Inferred from direct assay PubMed 18718702. Source: UniProtKB

external side of plasma membrane

Inferred from electronic annotation. Source: Ensembl

integral component of membrane

Non-traceable author statement Ref.1. Source: UniProtKB

integral component of plasma membrane

Traceable author statement PubMed 11066060. Source: MGI

plasma membrane

Inferred from direct assay PubMed 18718702. Source: UniProtKB

protein complex

Inferred from electronic annotation. Source: Ensembl

   Molecular_functionporin activity

Inferred from electronic annotation. Source: Ensembl

water channel activity

Inferred from direct assay Ref.1. Source: UniProtKB

Complete GO annotation...

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 2 (identifier: P55088-1)

Also known as: MIWC2; AQP4-M1;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 1 (identifier: P55088-2)

Also known as: MIWC1; AQP4-M21;

The sequence of this isoform differs from the canonical sequence as follows:
     1-22: Missing.
Isoform 3 (identifier: P55088-3)

Also known as: MIWC3;

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MSDGAAARRWG → MVHGFGCFVFFFLISLSSLWASEDSTCNSTLPLCHLATTLDCC

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 323323Aquaporin-4
PRO_0000063949

Regions

Topological domain1 – 3636Cytoplasmic Potential
Transmembrane37 – 5822Helical; Potential
Topological domain59 – 646Extracellular Potential
Transmembrane65 – 8521Helical; Potential
Topological domain86 – 11530Cytoplasmic Potential
Transmembrane116 – 13621Helical; Potential
Topological domain137 – 15519Extracellular Potential
Transmembrane156 – 17621Helical; Potential
Topological domain177 – 1848Cytoplasmic Potential
Transmembrane185 – 20521Helical; Potential
Topological domain206 – 23126Extracellular Potential
Transmembrane232 – 25221Helical; Potential
Topological domain253 – 32371Cytoplasmic Potential
Motif97 – 993NPA 1
Motif213 – 2153NPA 2

Amino acid modifications

Modified residue1111Phosphoserine; by PKG By similarity
Modified residue1801Phosphoserine; by PKC By similarity
Modified residue2851Phosphoserine By similarity
Modified residue3211Phosphoserine By similarity
Glycosylation1531N-linked (GlcNAc...) Potential
Glycosylation2061N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence1 – 2222Missing in isoform 1.
VSP_003233
Alternative sequence1 – 1111MSDGAAARRWG → MVHGFGCFVFFFLISLSSLW ASEDSTCNSTLPLCHLATTL DCC in isoform 3.
VSP_003234
Natural variant41G → R. Ref.3

Experimental info

Sequence conflict371A → S in AAB41571. Ref.1
Sequence conflict511Missing in AAB41569. Ref.1
Sequence conflict511Missing in AAB41570. Ref.1
Sequence conflict881F → L in AAB41569. Ref.1
Sequence conflict881F → L in AAB41570. Ref.1
Sequence conflict1741I → V in AAB41569. Ref.1
Sequence conflict1741I → V in AAB41570. Ref.1
Sequence conflict3131K → R in AAB41569. Ref.1
Sequence conflict3131K → R in AAB41570. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 2 (MIWC2) (AQP4-M1) [UniParc].

Last modified May 10, 2004. Version 2.
Checksum: 9AC638A3C3F412E2

FASTA32334,436
        10         20         30         40         50         60 
MSDGAAARRW GKCGHSCSRE SIMVAFKGVW TQAFWKAVSA EFLATLIFVL LGVGSTINWG 

        70         80         90        100        110        120 
GSENPLPVDM VLISLCFGLS IATMVQCFGH ISGGHINPAV TVAMVCTRKI SIAKSVFYII 

       130        140        150        160        170        180 
AQCLGAIIGA GILYLVTPPS VVGGLGVTTV HGNLTAGHGL LVELIITFQL VFTIFASCDS 

       190        200        210        220        230        240 
KRTDVTGSIA LAIGFSVAIG HLFAINYTGA SMNPARSFGP AVIMGNWANH WIYWVGPIMG 

       250        260        270        280        290        300 
AVLAGALYEY VFCPDVELKR RLKEAFSKAA QQTKGSYMEV EDNRSQVETE DLILKPGVVH 

       310        320 
VIDIDRGEEK KGKDSSGEVL SSV 

« Hide

Isoform 1 (MIWC1) (AQP4-M21) [UniParc].

Checksum: E2ADDA3C8E0A92A2
Show »

FASTA30132,088
Isoform 3 (MIWC3) [UniParc].

Checksum: CDA0A8D89A1AC74A
Show »

FASTA35537,977

References

« Hide 'large scale' references
[1]"Gene structure, cDNA cloning, and expression of a mouse mercurial-insensitive water channel."
Ma T., Yang B., Verkman A.S.
Genomics 33:382-388(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3).
Strain: C57BL/6.
Tissue: Brain.
[2]"Cloning and chromosomal localization of mouse aquaporin 4: exclusion of a candidate mutant phenotype, ataxia."
Turtzo L.C., Lee M.D., Lu M., Smith B.L., Copeland N.G., Gilbert D.J., Jenkins N.A., Agre P.
Genomics 41:267-270(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
Strain: C57BL/6J.
Tissue: Cerebellum.
[3]"Identification of a new form of AQP4 mRNA that is developmentally expressed in mouse brain."
Zelenin S., Gunnarson E., Alikina T., Bondar A., Aperia A.
Pediatr. Res. 48:335-339(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), VARIANT ARG-4.
[4]"Cloning of mouse full open reading frames in Gateway(R) system entry vector (pDONR201)."
Ebert L., Muenstermann E., Schatten R., Henze S., Bohn E., Mollenhauer J., Wiemann S., Schick M., Korn B.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Colon.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
U48398 mRNA. Translation: AAB41569.1.
U48397 mRNA. Translation: AAB41568.1.
U33012 mRNA. Translation: AAA84923.1.
U48400 Genomic DNA. Translation: AAB41571.1.
U48399 mRNA. Translation: AAB41570.1.
U88623 mRNA. Translation: AAC53155.1.
AF469168 mRNA. Translation: AAL73545.1.
AF469169 mRNA. Translation: AAL73546.1.
AF219992 Genomic DNA. Translation: AAG44243.2.
CT010362 mRNA. Translation: CAJ18569.1.
BC024526 mRNA. Translation: AAH24526.1.
CCDSCCDS29073.1. [P55088-1]
RefSeqNP_033830.2. NM_009700.2.
XP_006525603.1. XM_006525540.1. [P55088-2]
UniGeneMm.250786.

3D structure databases

ProteinModelPortalP55088.
SMRP55088. Positions 31-295.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

DIPDIP-59602N.
IntActP55088. 3 interactions.
MINTMINT-4088102.

Chemistry

ChEMBLCHEMBL5965.

PTM databases

PhosphoSiteP55088.

Proteomic databases

PaxDbP55088.
PRIDEP55088.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000079081; ENSMUSP00000078088; ENSMUSG00000024411.
GeneID11829.
KEGGmmu:11829.
UCSCuc008edq.2. mouse. [P55088-1]
uc008eds.2. mouse. [P55088-3]

Organism-specific databases

CTD361.
MGIMGI:107387. Aqp4.

Phylogenomic databases

eggNOGCOG0580.
GeneTreeENSGT00740000115463.
HOVERGENHBG000312.
KOK09866.
OrthoDBEOG7N8ZWD.
PhylomeDBP55088.
TreeFamTF312940.

Gene expression databases

BgeeP55088.
CleanExMM_AQP4.
GenevestigatorP55088.

Family and domain databases

Gene3D1.20.1080.10. 1 hit.
InterProIPR023271. Aquaporin-like.
IPR000425. MIP.
IPR022357. MIP_CS.
[Graphical view]
PANTHERPTHR19139. PTHR19139. 1 hit.
PfamPF00230. MIP. 1 hit.
[Graphical view]
PRINTSPR00783. MINTRINSICP.
SUPFAMSSF81338. SSF81338. 1 hit.
TIGRFAMsTIGR00861. MIP. 1 hit.
PROSITEPS00221. MIP. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSAQP4. mouse.
NextBio279739.
PROP55088.
SOURCESearch...

Entry information

Entry nameAQP4_MOUSE
AccessionPrimary (citable) accession number: P55088
Secondary accession number(s): P97818 expand/collapse secondary AC list , Q4FJP1, Q61131, Q61132, Q8VHE4, Q8VHE5, Q9EQI3
Entry history
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: May 10, 2004
Last modified: July 9, 2014
This is version 118 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot