SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P55088

- AQP4_MOUSE

UniProt

P55088 - AQP4_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Aquaporin-4

Gene
Aqp4
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at transcript leveli

Functioni

Forms a water-specific channel. Osmoreceptor which regulates body water balance and mediates water flow within the central nervous system.

GO - Molecular functioni

  1. porin activity Source: Ensembl
  2. water channel activity Source: UniProtKB

GO - Biological processi

  1. carbon dioxide transport Source: Ensembl
  2. cellular response to estradiol stimulus Source: Ensembl
  3. cellular response to interferon-gamma Source: Ensembl
  4. female pregnancy Source: Ensembl
  5. hyperosmotic salinity response Source: Ensembl
  6. protein homooligomerization Source: Ensembl
  7. renal water absorption Source: MGI
  8. response to glucocorticoid Source: Ensembl
  9. response to radiation Source: Ensembl
  10. sensory perception of sound Source: MGI
  11. water homeostasis Source: UniProtKB
  12. water transport Source: MGI
Complete GO annotation...

Keywords - Biological processi

Transport

Enzyme and pathway databases

ReactomeiREACT_213947. Regulation of water balance by renal Aquaporins.

Names & Taxonomyi

Protein namesi
Recommended name:
Aquaporin-4
Short name:
AQP-4
Alternative name(s):
Mercurial-insensitive water channel
Short name:
MIWC
WCH4
Gene namesi
Name:Aqp4
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 18

Organism-specific databases

MGIiMGI:107387. Aqp4.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 3636Cytoplasmic Reviewed predictionAdd
BLAST
Transmembranei37 – 5822Helical; Reviewed predictionAdd
BLAST
Topological domaini59 – 646Extracellular Reviewed prediction
Transmembranei65 – 8521Helical; Reviewed predictionAdd
BLAST
Topological domaini86 – 11530Cytoplasmic Reviewed predictionAdd
BLAST
Transmembranei116 – 13621Helical; Reviewed predictionAdd
BLAST
Topological domaini137 – 15519Extracellular Reviewed predictionAdd
BLAST
Transmembranei156 – 17621Helical; Reviewed predictionAdd
BLAST
Topological domaini177 – 1848Cytoplasmic Reviewed prediction
Transmembranei185 – 20521Helical; Reviewed predictionAdd
BLAST
Topological domaini206 – 23126Extracellular Reviewed predictionAdd
BLAST
Transmembranei232 – 25221Helical; Reviewed predictionAdd
BLAST
Topological domaini253 – 32371Cytoplasmic Reviewed predictionAdd
BLAST

GO - Cellular componenti

  1. basolateral plasma membrane Source: MGI
  2. cell-cell junction Source: UniProtKB
  3. cytoplasm Source: UniProtKB
  4. external side of plasma membrane Source: Ensembl
  5. integral component of membrane Source: UniProtKB
  6. integral component of plasma membrane Source: MGI
  7. plasma membrane Source: UniProtKB
  8. protein complex Source: Ensembl
  9. T-tubule Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 323323Aquaporin-4PRO_0000063949Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei111 – 1111Phosphoserine; by PKG By similarity
Glycosylationi153 – 1531N-linked (GlcNAc...) Reviewed prediction
Modified residuei180 – 1801Phosphoserine; by PKC By similarity
Glycosylationi206 – 2061N-linked (GlcNAc...) Reviewed prediction
Modified residuei285 – 2851Phosphoserine By similarity
Modified residuei321 – 3211Phosphoserine By similarity

Post-translational modificationi

Phosphorylation by PKC at Ser-180 reduces conductance by 50%. Phosphorylation by PKG at Ser-111 in response to glutamats increases conductance by 40% By similarity.

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiP55088.
PRIDEiP55088.

PTM databases

PhosphoSiteiP55088.

Expressioni

Gene expression databases

BgeeiP55088.
CleanExiMM_AQP4.
GenevestigatoriP55088.

Interactioni

Subunit structurei

Homotetramer By similarity. Part of a complex containing MLC1, TRPV4, HEPACAM and ATP1B1 By similarity.

Protein-protein interaction databases

DIPiDIP-59602N.
IntActiP55088. 3 interactions.
MINTiMINT-4088102.

Structurei

3D structure databases

ProteinModelPortaliP55088.
SMRiP55088. Positions 31-295.

Family & Domainsi

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi97 – 993NPA 1
Motifi213 – 2153NPA 2

Domaini

Aquaporins contain two tandem repeats each containing three membrane-spanning domains and a pore-forming loop with the signature motif Asn-Pro-Ala (NPA).

Sequence similaritiesi

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG0580.
GeneTreeiENSGT00740000115463.
HOVERGENiHBG000312.
KOiK09866.
OrthoDBiEOG7N8ZWD.
PhylomeDBiP55088.
TreeFamiTF312940.

Family and domain databases

Gene3Di1.20.1080.10. 1 hit.
InterProiIPR023271. Aquaporin-like.
IPR000425. MIP.
IPR022357. MIP_CS.
[Graphical view]
PANTHERiPTHR19139. PTHR19139. 1 hit.
PfamiPF00230. MIP. 1 hit.
[Graphical view]
PRINTSiPR00783. MINTRINSICP.
SUPFAMiSSF81338. SSF81338. 1 hit.
TIGRFAMsiTIGR00861. MIP. 1 hit.
PROSITEiPS00221. MIP. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 2 (identifier: P55088-1) [UniParc]FASTAAdd to Basket

Also known as: MIWC2, AQP4-M1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MSDGAAARRW GKCGHSCSRE SIMVAFKGVW TQAFWKAVSA EFLATLIFVL    50
LGVGSTINWG GSENPLPVDM VLISLCFGLS IATMVQCFGH ISGGHINPAV 100
TVAMVCTRKI SIAKSVFYII AQCLGAIIGA GILYLVTPPS VVGGLGVTTV 150
HGNLTAGHGL LVELIITFQL VFTIFASCDS KRTDVTGSIA LAIGFSVAIG 200
HLFAINYTGA SMNPARSFGP AVIMGNWANH WIYWVGPIMG AVLAGALYEY 250
VFCPDVELKR RLKEAFSKAA QQTKGSYMEV EDNRSQVETE DLILKPGVVH 300
VIDIDRGEEK KGKDSSGEVL SSV 323
Length:323
Mass (Da):34,436
Last modified:May 10, 2004 - v2
Checksum:i9AC638A3C3F412E2
GO
Isoform 1 (identifier: P55088-2) [UniParc]FASTAAdd to Basket

Also known as: MIWC1, AQP4-M21

The sequence of this isoform differs from the canonical sequence as follows:
     1-22: Missing.

Show »
Length:301
Mass (Da):32,088
Checksum:iE2ADDA3C8E0A92A2
GO
Isoform 3 (identifier: P55088-3) [UniParc]FASTAAdd to Basket

Also known as: MIWC3

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MSDGAAARRWG → MVHGFGCFVFFFLISLSSLWASEDSTCNSTLPLCHLATTLDCC

Show »
Length:355
Mass (Da):37,977
Checksum:iCDA0A8D89A1AC74A
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti4 – 41G → R.1 Publication

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 2222Missing in isoform 1. VSP_003233Add
BLAST
Alternative sequencei1 – 1111MSDGAAARRWG → MVHGFGCFVFFFLISLSSLW ASEDSTCNSTLPLCHLATTL DCC in isoform 3. VSP_003234Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti37 – 371A → S in AAB41571. 1 Publication
Sequence conflicti51 – 511Missing in AAB41569. 1 Publication
Sequence conflicti51 – 511Missing in AAB41570. 1 Publication
Sequence conflicti88 – 881F → L in AAB41569. 1 Publication
Sequence conflicti88 – 881F → L in AAB41570. 1 Publication
Sequence conflicti174 – 1741I → V in AAB41569. 1 Publication
Sequence conflicti174 – 1741I → V in AAB41570. 1 Publication
Sequence conflicti313 – 3131K → R in AAB41569. 1 Publication
Sequence conflicti313 – 3131K → R in AAB41570. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U48398 mRNA. Translation: AAB41569.1.
U48397 mRNA. Translation: AAB41568.1.
U33012 mRNA. Translation: AAA84923.1.
U48400 Genomic DNA. Translation: AAB41571.1.
U48399 mRNA. Translation: AAB41570.1.
U88623 mRNA. Translation: AAC53155.1.
AF469168 mRNA. Translation: AAL73545.1.
AF469169 mRNA. Translation: AAL73546.1.
AF219992 Genomic DNA. Translation: AAG44243.2.
CT010362 mRNA. Translation: CAJ18569.1.
BC024526 mRNA. Translation: AAH24526.1.
CCDSiCCDS29073.1. [P55088-1]
RefSeqiNP_033830.2. NM_009700.2.
XP_006525603.1. XM_006525540.1. [P55088-2]
UniGeneiMm.250786.

Genome annotation databases

EnsembliENSMUST00000079081; ENSMUSP00000078088; ENSMUSG00000024411.
GeneIDi11829.
KEGGimmu:11829.
UCSCiuc008edq.2. mouse. [P55088-1]
uc008eds.2. mouse. [P55088-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U48398 mRNA. Translation: AAB41569.1 .
U48397 mRNA. Translation: AAB41568.1 .
U33012 mRNA. Translation: AAA84923.1 .
U48400 Genomic DNA. Translation: AAB41571.1 .
U48399 mRNA. Translation: AAB41570.1 .
U88623 mRNA. Translation: AAC53155.1 .
AF469168 mRNA. Translation: AAL73545.1 .
AF469169 mRNA. Translation: AAL73546.1 .
AF219992 Genomic DNA. Translation: AAG44243.2 .
CT010362 mRNA. Translation: CAJ18569.1 .
BC024526 mRNA. Translation: AAH24526.1 .
CCDSi CCDS29073.1. [P55088-1 ]
RefSeqi NP_033830.2. NM_009700.2.
XP_006525603.1. XM_006525540.1. [P55088-2 ]
UniGenei Mm.250786.

3D structure databases

ProteinModelPortali P55088.
SMRi P55088. Positions 31-295.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

DIPi DIP-59602N.
IntActi P55088. 3 interactions.
MINTi MINT-4088102.

Chemistry

ChEMBLi CHEMBL5965.

PTM databases

PhosphoSitei P55088.

Proteomic databases

PaxDbi P55088.
PRIDEi P55088.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000079081 ; ENSMUSP00000078088 ; ENSMUSG00000024411 .
GeneIDi 11829.
KEGGi mmu:11829.
UCSCi uc008edq.2. mouse. [P55088-1 ]
uc008eds.2. mouse. [P55088-3 ]

Organism-specific databases

CTDi 361.
MGIi MGI:107387. Aqp4.

Phylogenomic databases

eggNOGi COG0580.
GeneTreei ENSGT00740000115463.
HOVERGENi HBG000312.
KOi K09866.
OrthoDBi EOG7N8ZWD.
PhylomeDBi P55088.
TreeFami TF312940.

Enzyme and pathway databases

Reactomei REACT_213947. Regulation of water balance by renal Aquaporins.

Miscellaneous databases

ChiTaRSi AQP4. mouse.
NextBioi 279739.
PROi P55088.
SOURCEi Search...

Gene expression databases

Bgeei P55088.
CleanExi MM_AQP4.
Genevestigatori P55088.

Family and domain databases

Gene3Di 1.20.1080.10. 1 hit.
InterProi IPR023271. Aquaporin-like.
IPR000425. MIP.
IPR022357. MIP_CS.
[Graphical view ]
PANTHERi PTHR19139. PTHR19139. 1 hit.
Pfami PF00230. MIP. 1 hit.
[Graphical view ]
PRINTSi PR00783. MINTRINSICP.
SUPFAMi SSF81338. SSF81338. 1 hit.
TIGRFAMsi TIGR00861. MIP. 1 hit.
PROSITEi PS00221. MIP. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Gene structure, cDNA cloning, and expression of a mouse mercurial-insensitive water channel."
    Ma T., Yang B., Verkman A.S.
    Genomics 33:382-388(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3).
    Strain: C57BL/6.
    Tissue: Brain.
  2. "Cloning and chromosomal localization of mouse aquaporin 4: exclusion of a candidate mutant phenotype, ataxia."
    Turtzo L.C., Lee M.D., Lu M., Smith B.L., Copeland N.G., Gilbert D.J., Jenkins N.A., Agre P.
    Genomics 41:267-270(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Strain: C57BL/6J.
    Tissue: Cerebellum.
  3. "Identification of a new form of AQP4 mRNA that is developmentally expressed in mouse brain."
    Zelenin S., Gunnarson E., Alikina T., Bondar A., Aperia A.
    Pediatr. Res. 48:335-339(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), VARIANT ARG-4.
  4. "Cloning of mouse full open reading frames in Gateway(R) system entry vector (pDONR201)."
    Ebert L., Muenstermann E., Schatten R., Henze S., Bohn E., Mollenhauer J., Wiemann S., Schick M., Korn B.
    Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Colon.

Entry informationi

Entry nameiAQP4_MOUSE
AccessioniPrimary (citable) accession number: P55088
Secondary accession number(s): P97818
, Q4FJP1, Q61131, Q61132, Q8VHE4, Q8VHE5, Q9EQI3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: May 10, 2004
Last modified: September 3, 2014
This is version 119 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi