Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P55088

- AQP4_MOUSE

UniProt

P55088 - AQP4_MOUSE

Protein

Aquaporin-4

Gene

Aqp4

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 120 (01 Oct 2014)
      Sequence version 2 (10 May 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Forms a water-specific channel. Osmoreceptor which regulates body water balance and mediates water flow within the central nervous system.

    GO - Molecular functioni

    1. porin activity Source: Ensembl
    2. water channel activity Source: UniProtKB

    GO - Biological processi

    1. carbon dioxide transport Source: Ensembl
    2. cellular response to estradiol stimulus Source: Ensembl
    3. cellular response to interferon-gamma Source: Ensembl
    4. female pregnancy Source: Ensembl
    5. hyperosmotic salinity response Source: Ensembl
    6. protein homooligomerization Source: Ensembl
    7. renal water absorption Source: MGI
    8. response to glucocorticoid Source: Ensembl
    9. response to radiation Source: Ensembl
    10. sensory perception of sound Source: MGI
    11. water homeostasis Source: UniProtKB
    12. water transport Source: MGI

    Keywords - Biological processi

    Transport

    Enzyme and pathway databases

    ReactomeiREACT_213947. Regulation of water balance by renal Aquaporins.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Aquaporin-4
    Short name:
    AQP-4
    Alternative name(s):
    Mercurial-insensitive water channel
    Short name:
    MIWC
    WCH4
    Gene namesi
    Name:Aqp4
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 18

    Organism-specific databases

    MGIiMGI:107387. Aqp4.

    Subcellular locationi

    GO - Cellular componenti

    1. basolateral plasma membrane Source: MGI
    2. cell-cell junction Source: UniProtKB
    3. cytoplasm Source: UniProtKB
    4. external side of plasma membrane Source: Ensembl
    5. integral component of membrane Source: UniProtKB
    6. integral component of plasma membrane Source: MGI
    7. plasma membrane Source: UniProtKB
    8. protein complex Source: Ensembl
    9. T-tubule Source: Ensembl

    Keywords - Cellular componenti

    Membrane

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 323323Aquaporin-4PRO_0000063949Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei111 – 1111Phosphoserine; by PKGBy similarity
    Glycosylationi153 – 1531N-linked (GlcNAc...)Sequence Analysis
    Modified residuei180 – 1801Phosphoserine; by PKCBy similarity
    Glycosylationi206 – 2061N-linked (GlcNAc...)Sequence Analysis
    Modified residuei285 – 2851PhosphoserineBy similarity
    Modified residuei321 – 3211PhosphoserineBy similarity

    Post-translational modificationi

    Phosphorylation by PKC at Ser-180 reduces conductance by 50%. Phosphorylation by PKG at Ser-111 in response to glutamats increases conductance by 40% By similarity.By similarity

    Keywords - PTMi

    Glycoprotein, Phosphoprotein

    Proteomic databases

    PaxDbiP55088.
    PRIDEiP55088.

    PTM databases

    PhosphoSiteiP55088.

    Expressioni

    Gene expression databases

    BgeeiP55088.
    CleanExiMM_AQP4.
    GenevestigatoriP55088.

    Interactioni

    Subunit structurei

    Homotetramer. Part of a complex containing MLC1, TRPV4, HEPACAM and ATP1B1.By similarity

    Protein-protein interaction databases

    DIPiDIP-59602N.
    IntActiP55088. 3 interactions.
    MINTiMINT-4088102.

    Structurei

    3D structure databases

    ProteinModelPortaliP55088.
    SMRiP55088. Positions 31-295.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 3636CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini59 – 646ExtracellularSequence Analysis
    Topological domaini86 – 11530CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini137 – 15519ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini177 – 1848CytoplasmicSequence Analysis
    Topological domaini206 – 23126ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini253 – 32371CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei37 – 5822HelicalSequence AnalysisAdd
    BLAST
    Transmembranei65 – 8521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei116 – 13621HelicalSequence AnalysisAdd
    BLAST
    Transmembranei156 – 17621HelicalSequence AnalysisAdd
    BLAST
    Transmembranei185 – 20521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei232 – 25221HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi97 – 993NPA 1
    Motifi213 – 2153NPA 2

    Domaini

    Aquaporins contain two tandem repeats each containing three membrane-spanning domains and a pore-forming loop with the signature motif Asn-Pro-Ala (NPA).

    Sequence similaritiesi

    Keywords - Domaini

    Repeat, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG0580.
    GeneTreeiENSGT00740000115463.
    HOVERGENiHBG000312.
    KOiK09866.
    OrthoDBiEOG7N8ZWD.
    PhylomeDBiP55088.
    TreeFamiTF312940.

    Family and domain databases

    Gene3Di1.20.1080.10. 1 hit.
    InterProiIPR023271. Aquaporin-like.
    IPR000425. MIP.
    IPR022357. MIP_CS.
    [Graphical view]
    PANTHERiPTHR19139. PTHR19139. 1 hit.
    PfamiPF00230. MIP. 1 hit.
    [Graphical view]
    PRINTSiPR00783. MINTRINSICP.
    SUPFAMiSSF81338. SSF81338. 1 hit.
    TIGRFAMsiTIGR00861. MIP. 1 hit.
    PROSITEiPS00221. MIP. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 2 (identifier: P55088-1) [UniParc]FASTAAdd to Basket

    Also known as: MIWC2, AQP4-M1

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSDGAAARRW GKCGHSCSRE SIMVAFKGVW TQAFWKAVSA EFLATLIFVL    50
    LGVGSTINWG GSENPLPVDM VLISLCFGLS IATMVQCFGH ISGGHINPAV 100
    TVAMVCTRKI SIAKSVFYII AQCLGAIIGA GILYLVTPPS VVGGLGVTTV 150
    HGNLTAGHGL LVELIITFQL VFTIFASCDS KRTDVTGSIA LAIGFSVAIG 200
    HLFAINYTGA SMNPARSFGP AVIMGNWANH WIYWVGPIMG AVLAGALYEY 250
    VFCPDVELKR RLKEAFSKAA QQTKGSYMEV EDNRSQVETE DLILKPGVVH 300
    VIDIDRGEEK KGKDSSGEVL SSV 323
    Length:323
    Mass (Da):34,436
    Last modified:May 10, 2004 - v2
    Checksum:i9AC638A3C3F412E2
    GO
    Isoform 1 (identifier: P55088-2) [UniParc]FASTAAdd to Basket

    Also known as: MIWC1, AQP4-M21

    The sequence of this isoform differs from the canonical sequence as follows:
         1-22: Missing.

    Show »
    Length:301
    Mass (Da):32,088
    Checksum:iE2ADDA3C8E0A92A2
    GO
    Isoform 3 (identifier: P55088-3) [UniParc]FASTAAdd to Basket

    Also known as: MIWC3

    The sequence of this isoform differs from the canonical sequence as follows:
         1-11: MSDGAAARRWG → MVHGFGCFVFFFLISLSSLWASEDSTCNSTLPLCHLATTLDCC

    Show »
    Length:355
    Mass (Da):37,977
    Checksum:iCDA0A8D89A1AC74A
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti37 – 371A → S in AAB41571. (PubMed:8660998)Curated
    Sequence conflicti51 – 511Missing in AAB41569. (PubMed:8660998)Curated
    Sequence conflicti51 – 511Missing in AAB41570. (PubMed:8660998)Curated
    Sequence conflicti88 – 881F → L in AAB41569. (PubMed:8660998)Curated
    Sequence conflicti88 – 881F → L in AAB41570. (PubMed:8660998)Curated
    Sequence conflicti174 – 1741I → V in AAB41569. (PubMed:8660998)Curated
    Sequence conflicti174 – 1741I → V in AAB41570. (PubMed:8660998)Curated
    Sequence conflicti313 – 3131K → R in AAB41569. (PubMed:8660998)Curated
    Sequence conflicti313 – 3131K → R in AAB41570. (PubMed:8660998)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti4 – 41G → R.1 Publication

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 2222Missing in isoform 1. 3 PublicationsVSP_003233Add
    BLAST
    Alternative sequencei1 – 1111MSDGAAARRWG → MVHGFGCFVFFFLISLSSLW ASEDSTCNSTLPLCHLATTL DCC in isoform 3. 1 PublicationVSP_003234Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U48398 mRNA. Translation: AAB41569.1.
    U48397 mRNA. Translation: AAB41568.1.
    U33012 mRNA. Translation: AAA84923.1.
    U48400 Genomic DNA. Translation: AAB41571.1.
    U48399 mRNA. Translation: AAB41570.1.
    U88623 mRNA. Translation: AAC53155.1.
    AF469168 mRNA. Translation: AAL73545.1.
    AF469169 mRNA. Translation: AAL73546.1.
    AF219992 Genomic DNA. Translation: AAG44243.2.
    CT010362 mRNA. Translation: CAJ18569.1.
    BC024526 mRNA. Translation: AAH24526.1.
    CCDSiCCDS29073.1. [P55088-1]
    RefSeqiNP_033830.2. NM_009700.2.
    XP_006525603.1. XM_006525540.1. [P55088-2]
    UniGeneiMm.250786.

    Genome annotation databases

    EnsembliENSMUST00000079081; ENSMUSP00000078088; ENSMUSG00000024411.
    GeneIDi11829.
    KEGGimmu:11829.
    UCSCiuc008edq.2. mouse. [P55088-1]
    uc008eds.2. mouse. [P55088-3]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U48398 mRNA. Translation: AAB41569.1 .
    U48397 mRNA. Translation: AAB41568.1 .
    U33012 mRNA. Translation: AAA84923.1 .
    U48400 Genomic DNA. Translation: AAB41571.1 .
    U48399 mRNA. Translation: AAB41570.1 .
    U88623 mRNA. Translation: AAC53155.1 .
    AF469168 mRNA. Translation: AAL73545.1 .
    AF469169 mRNA. Translation: AAL73546.1 .
    AF219992 Genomic DNA. Translation: AAG44243.2 .
    CT010362 mRNA. Translation: CAJ18569.1 .
    BC024526 mRNA. Translation: AAH24526.1 .
    CCDSi CCDS29073.1. [P55088-1 ]
    RefSeqi NP_033830.2. NM_009700.2.
    XP_006525603.1. XM_006525540.1. [P55088-2 ]
    UniGenei Mm.250786.

    3D structure databases

    ProteinModelPortali P55088.
    SMRi P55088. Positions 31-295.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    DIPi DIP-59602N.
    IntActi P55088. 3 interactions.
    MINTi MINT-4088102.

    Chemistry

    ChEMBLi CHEMBL5965.

    PTM databases

    PhosphoSitei P55088.

    Proteomic databases

    PaxDbi P55088.
    PRIDEi P55088.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000079081 ; ENSMUSP00000078088 ; ENSMUSG00000024411 .
    GeneIDi 11829.
    KEGGi mmu:11829.
    UCSCi uc008edq.2. mouse. [P55088-1 ]
    uc008eds.2. mouse. [P55088-3 ]

    Organism-specific databases

    CTDi 361.
    MGIi MGI:107387. Aqp4.

    Phylogenomic databases

    eggNOGi COG0580.
    GeneTreei ENSGT00740000115463.
    HOVERGENi HBG000312.
    KOi K09866.
    OrthoDBi EOG7N8ZWD.
    PhylomeDBi P55088.
    TreeFami TF312940.

    Enzyme and pathway databases

    Reactomei REACT_213947. Regulation of water balance by renal Aquaporins.

    Miscellaneous databases

    ChiTaRSi AQP4. mouse.
    NextBioi 279739.
    PROi P55088.
    SOURCEi Search...

    Gene expression databases

    Bgeei P55088.
    CleanExi MM_AQP4.
    Genevestigatori P55088.

    Family and domain databases

    Gene3Di 1.20.1080.10. 1 hit.
    InterProi IPR023271. Aquaporin-like.
    IPR000425. MIP.
    IPR022357. MIP_CS.
    [Graphical view ]
    PANTHERi PTHR19139. PTHR19139. 1 hit.
    Pfami PF00230. MIP. 1 hit.
    [Graphical view ]
    PRINTSi PR00783. MINTRINSICP.
    SUPFAMi SSF81338. SSF81338. 1 hit.
    TIGRFAMsi TIGR00861. MIP. 1 hit.
    PROSITEi PS00221. MIP. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Gene structure, cDNA cloning, and expression of a mouse mercurial-insensitive water channel."
      Ma T., Yang B., Verkman A.S.
      Genomics 33:382-388(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3).
      Strain: C57BL/6.
      Tissue: Brain.
    2. "Cloning and chromosomal localization of mouse aquaporin 4: exclusion of a candidate mutant phenotype, ataxia."
      Turtzo L.C., Lee M.D., Lu M., Smith B.L., Copeland N.G., Gilbert D.J., Jenkins N.A., Agre P.
      Genomics 41:267-270(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
      Strain: C57BL/6J.
      Tissue: Cerebellum.
    3. "Identification of a new form of AQP4 mRNA that is developmentally expressed in mouse brain."
      Zelenin S., Gunnarson E., Alikina T., Bondar A., Aperia A.
      Pediatr. Res. 48:335-339(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), VARIANT ARG-4.
    4. "Cloning of mouse full open reading frames in Gateway(R) system entry vector (pDONR201)."
      Ebert L., Muenstermann E., Schatten R., Henze S., Bohn E., Mollenhauer J., Wiemann S., Schick M., Korn B.
      Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Colon.

    Entry informationi

    Entry nameiAQP4_MOUSE
    AccessioniPrimary (citable) accession number: P55088
    Secondary accession number(s): P97818
    , Q4FJP1, Q61131, Q61132, Q8VHE4, Q8VHE5, Q9EQI3
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 1, 1996
    Last sequence update: May 10, 2004
    Last modified: October 1, 2014
    This is version 120 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3